KEGG   Homo sapiens (human): 10008Help
Entry
10008             CDS       T01001                                 

Gene name
KCNE3, HOKPP, HYPP, MiRP2
Definition
potassium voltage-gated channel, Isk-related family, member 3
Orthology
K04897  
potassium voltage-gated channel Isk-related subfamily E member 3
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Disease
H00215  
Periodic paralysis
H00728  
Brugada syndrome (BRS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    10008 (KCNE3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNE, (Isk)
   10008 (KCNE3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.4
AA seq 103 aa AA seqDB search
METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMY
ILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggagactaccaatggaacggagacctggtatgagagcctgcatgccgtgctgaaggct
ctaaatgccactcttcacagcaatttgctctgccggccagggccagggctggggccagac
aaccagactgaagagaggcgggccagcctacctggccgtgatgacaactcctacatgtac
attctctttgtcatgtttctatttgctgtaactgtgggcagcctcatcctgggatacacc
cgctcccgcaaagtggacaagcgtagtgacccctatcatgtgtatatcaagaaccgtgtg
tctatgatctaa

DBGET integrated database retrieval system