KEGG   Homo sapiens (human): 1001Help
Entry
1001              CDS       T01001                                 

Gene name
CDH3, CDHP, HJMD, PCAD
Definition
cadherin 3, type 1, P-cadherin (placental)
Orthology
K06796  
cadherin 3, type 1, P-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Disease
H00639  
Ectodermal dysplasia, ectrodactyly, and macular dystrophy (EEM syndrome)
H00785  
Congenital hypotrichosis with juvenile macular dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1001 (CDH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 829 aa AA seqDB search
MGLPRGPLASLLLLQVCWLQCAASEPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPG
QEPALFSTDNDDFTVRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENG
KGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAK
YELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTAT
DEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQA
TDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSP
AWRATYLIMGGDDGDHFTITTHPESNQGILTTRKGLDFEAKNQHTLYVEVTNEAPFVLKL
PTSTATIVVHVEDVNEAPVFVPPSKVVEVQEGIPTGEPVCVYTAEDPDKENQKISYRILR
DPAGWLAMDPDSGQVTAVGTLDREDEQFVRNNIYEVMVLAMDNGSPPTTGTGTLLLTLID
VNDHGPVPEPRQITICNQSPVRQVLNITDKDLSPHTSPFQAQLTDDSDIYWTAEVNEEGD
TVVLSLKKFLKQDTYDVHLSLSDHGNKEQLTVIRATVCDCHGHVETCPGPWKGGFILPVL
GAVLALLFLLLVLLLLVRKKRKIKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHR
GLEARPEVVLRNDVAPTIIPTPMYRPRPANPDEIGNFIIENLKAANTDPTAPPYDTLLVF
DYEGSGSDAASLSSLTSSASDQDQDYDYLNEWGSRFKKLADMYGGGEDD
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggggctccctcgtggacctctcgcgtctctcctccttctccaggtttgctggctgcag
tgcgcggcctccgagccgtgccgggcggtcttcagggaggctgaagtgaccttggaggcg
ggaggcgcggagcaggagcccggccaggcgctggggaaagtattcatgggctgccctggg
caagagccagctctgtttagcactgataatgatgacttcactgtgcggaatggcgagaca
gtccaggaaagaaggtcactgaaggaaaggaatccattgaagatcttcccatccaaacgt
atcttacgaagacacaagagagattgggtggttgctccaatatctgtccctgaaaatggc
aagggtcccttcccccagagactgaatcagctcaagtctaataaagatagagacaccaag
attttctacagcatcacggggccgggggcagacagcccccctgagggtgtcttcgctgta
gagaaggagacaggctggttgttgttgaataagccactggaccgggaggagattgccaag
tatgagctctttggccacgctgtgtcagagaatggtgcctcagtggaggaccccatgaac
atctccatcatcgtgaccgaccagaatgaccacaagcccaagtttacccaggacaccttc
cgagggagtgtcttagagggagtcctaccaggtacttctgtgatgcaggtgacagccacg
gatgaggatgatgccatctacacctacaatggggtggttgcttactccatccatagccaa
gaaccaaaggacccacacgacctcatgttcaccattcaccggagcacaggcaccatcagc
gtcatctccagtggcctggaccgggaaaaagtccctgagtacacactgaccatccaggcc
acagacatggatggggacggctccaccaccacggcagtggcagtagtggagatccttgat
gccaatgacaatgctcccatgtttgacccccagaagtacgaggcccatgtgcctgagaat
gcagtgggccatgaggtgcagaggctgacggtcactgatctggacgcccccaactcacca
gcgtggcgtgccacctaccttatcatgggcggtgacgacggggaccattttaccatcacc
acccaccctgagagcaaccagggcatcctgacaaccaggaagggtttggattttgaggcc
aaaaaccagcacaccctgtacgttgaagtgaccaacgaggccccttttgtgctgaagctc
ccaacctccacagccaccatagtggtccacgtggaggatgtgaatgaggcacctgtgttt
gtcccaccctccaaagtcgttgaggtccaggagggcatccccactggggagcctgtgtgt
gtctacactgcagaagaccctgacaaggagaatcaaaagatcagctaccgcatcctgaga
gacccagcagggtggctagccatggacccagacagtgggcaggtcacagctgtgggcacc
ctcgaccgtgaggatgagcagtttgtgaggaacaacatctatgaagtcatggtcttggcc
atggacaatggaagccctcccaccactggcacgggaacccttctgctaacactgattgat
gtcaatgaccatggcccagtccctgagccccgtcagatcaccatctgcaaccaaagccct
gtgcgccaggtgctgaacatcacggacaaggacctgtctccccacacctcccctttccag
gcccagctcacagatgactcagacatctactggacggcagaggtcaacgaggaaggtgac
acagtggtcttgtccctgaagaagttcctgaagcaggatacatatgacgtgcacctttct
ctgtctgaccatggcaacaaagagcagctgacggtgatcagggccactgtgtgcgactgc
catggccatgtcgaaacctgccctggaccctggaagggaggtttcatcctccctgtgctg
ggggctgtcctggctctgctgttcctcctgctggtgctgcttttgttggtgagaaagaag
cggaagatcaaggagcccctcctactcccagaagatgacacccgtgacaacgtcttctac
tatggcgaagaggggggtggcgaagaggaccaggactatgacatcacccagctccaccga
ggtctggaggccaggccggaggtggttctccgcaatgacgtggcaccaaccatcatcccg
acacccatgtaccgtcctcggccagccaacccagatgaaatcggcaactttataattgag
aacctgaaggcggctaacacagaccccacagccccgccctacgacaccctcttggtgttc
gactatgagggcagcggctccgacgccgcgtccctgagctccctcacctcctccgcctcc
gaccaagaccaagattacgattatctgaacgagtggggcagccgcttcaagaagctggca
gacatgtacggtggcggggaggacgactag

DBGET integrated database retrieval system