KEGG   Homo sapiens (human): 10010Help
Entry
10010             CDS       T01001                                 

Gene name
TANK, I-TRAF, ITRAF, TRAF2
Definition
TRAF family member-associated NFKB activator
Orthology
K12650  
TRAF family member-associated NF-kappa-B activator
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    10010 (TANK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24-q31
AA seq 425 aa AA seqDB search
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKS
QLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPRK
ETSARSLGSPLLHERGNIEKTFWDLKEEFHKICMLAKAQKDHLSKLNIPDTATETQCSVP
IQCTDKTDKQEALFKPQAKDDINRGAPSITSVTPRGLCRDEEDTSFESLSKFNVKFPPMD
NDSTFLHSTPERPGILSPATSEAVCQEKFNMEFRDNPGNFVKTEETLFEIQGIDPIASAI
QNLKTTDKTKPSNLVNTCIRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGK
AIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH
FNGET
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaacattggcgagcaactcaataaagcgtatgaagccttccggcaggcatgc
atggatagagattctgcagtaaaagaattacagcaaaagactgagaactatgagcagaga
atacgtgaacaacaggaacagctgtcacttcaacagactattattgacaagctaaaatct
cagttacttcttgtgaattccactcaagataacaattatggctgtgttcctctgcttgaa
gacagtgaaacaagaaagaataatttgactcttgatcagccacaagataaagtgatttca
ggaatagcaagagaaaaactaccaaaggtaagaagacaagaggtttcttctcctagaaaa
gaaacttcagcaaggagtcttggcagtcctttgctccatgaaaggggtaatatagagaag
actttctgggatctgaaagaagaatttcataaaatatgcatgctagcaaaagcacagaaa
gaccacttaagcaaacttaatataccagacactgcaactgaaacacagtgctctgtgcct
atacagtgtacggataaaacagataaacaagaagcgctgtttaagcctcaggctaaagat
gatataaatagaggtgcaccatccatcacatctgtcacaccaagaggactgtgcagagat
gaggaagacacctcttttgaatcactttctaaattcaatgtcaagtttccacctatggac
aatgactcaactttcttacatagcactccagagagacccggcatccttagtcctgccacg
tctgaggcagtgtgccaagagaaatttaatatggagttcagagacaacccagggaacttt
gttaaaacagaagaaactttatttgaaattcagggaattgaccccatagcttcagctata
caaaaccttaaaacaactgacaaaacaaagccctcaaatctcgtaaacacttgtatcagg
acaactctggatagagctgcgtgtttgccacctggagaccataatgcattatatgtaaat
agcttcccacttctggacccatctgatgcaccttttccctcactcgattccccgggaaaa
gcaatccgaggaccacagcagcccatttggaagccctttcctaatcaagacagtgactcg
gtggtactaagtggcacagactcagaactgcatatacctcgagtatgtgaattctgtcaa
gcagttttcccaccatccattacatccaggggggatttccttcggcatcttaattcacac
ttcaatggagagacttaa

DBGET integrated database retrieval system