KEGG   Homo sapiens (human): 100101267Help
Entry
100101267         CDS       T01001                                 

Gene name
POM121C, POM121-2
Definition
POM121 transmembrane nucleoporin C
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
7q11.2
AA seq 987 aa AA seqDB search
MVCSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTV
EEEDQIFLDGQENKRRRHDSSGSGHSAFEPLVASGVPASFVPKPGSLKRGLNSQSSDDHL
NKRSRSSSMSSLTGAYTSGIPSSSRNAITSSYSSTRGISQLWKRNGPSSSPFSSPASSRS
QTPERPAKKIREEELCHHSSSSTPLAADKESQGEKAADTTPRKKQNSNSQSTPGSSGQRK
RKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNQALEDKSDAASNSVTET
PPTTQPSFTFTLPAAATASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEAL
SPPKTPSLLPPLGLSQSGPPGLLPSPSFDSKPPTTLLGLIPAPSMVPATDTKAPPTLQAE
TATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPAASSASPMFKPIFTAPPKSEKEGLTP
PGPSVSATAPSSSSLPTTTSTTAPTFQPVFSSMGPPASVPLPAPFFKQTTTPATAPTTTA
PLFTGLASATSAVAPITSASPSTDSASKPAFGFGINSVSSSSVSTTTSTATAASQPFLFG
APQASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLPTAVPTATSSSAADFSGFGSTL
ATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAEGQPPGAAKP
ALTPSFGSSFTFGNSAAPAPATAPTPAPASTIKIVPAHVPTPIQPTFGGATHSAFGLKAT
ASAFGAPASSQPAFGGSTAVFSFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGS
AAPAGSGSFGINVATPGSSATTGAFSFGAGQSGSTATSTPFTGGLGQNALGTTGQSTPFA
FNVGSTTESKPVFGGTATPTFGQNTPAPGVGTSGSSLSFGASSAPAQGFVGVGPFGSAAP
SFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtagcccagtgactgtgaggatcgcccctcctgacagaagattttcacgttct
gcgataccagagcagataatcagctcaacactgtcgtcaccatcaagtaatgccccagac
ccatgtgcaaaggagactgtactgagtgccctcaaagagaagaagaagaaaaggacagtg
gaggaagaagaccaaatattccttgatggccaggaaaataaaagaaggcgccatgatagc
agtggcagtggacattcagcatttgagcccctggtggccagtggagtccccgcttctttt
gtgcctaagcctgggtctctgaagagaggcctcaattctcagagctcagatgaccacttg
aataagagatcccgaagctcttccatgagctccttgacaggcgcttacacaagtggcatc
cctagctccagccgcaatgccattaccagttcctacagctccactcgaggcatctcacag
ctgtggaagagaaatggccccagttcatcacccttctctagcccagcctcatcccgctcc
cagacaccggagaggccagcaaagaaaataagagaagaagagctgtgtcatcattccagt
tcttcaactccattggcagcagacaaggagtcccagggagaaaaggctgcagatacaacc
ccaaggaagaaacaaaactcgaattctcagtctacacctggcagctctgggcagcgtaag
cggaaagttcagctgctgccttctcggcgaggggaacagctgaccttgcctccacctccc
cagcttggctattcgatcactgccgaggacctagacttagagaagaaggcttcattacag
tggttcaaccaggccttggaggacaagagtgatgctgcctcgaactctgtcactgagacc
ccacctaccactcagccttcatttacctttaccctgcctgctgctgcaactgcctcccca
cccacctccctcctggccccaagcaccaacccactgttagagagcttgaagaagatgcag
actcccccgagcctgccaccctgcccagaatctgctggagcagcaaccactgaggccctc
tcacctccaaagacacccagcctcctacccccgctgggtttatcacagtcagggccgcca
gggctgctccccagcccctcctttgactccaaacccccgaccactttgctggggctgatc
cctgctccatccatggtaccagccactgacaccaaggcacctccaacccttcaggcagag
acggctaccaaaccccaagccacatctgccccgtcccccgcccccaagcaaagcttcctg
tttggaacacagaacacctcaccttccagccctgccgcccctgctgcatcttcagcatct
cccatgttcaagcccattttcacggctccacccaagagtgagaaggaaggcctcacaccg
cctggcccttcagtctcagccacagcgccctccagctcctccctccccacgaccaccagc
accacagccccgaccttccagcctgtctttagcagcatggggccacctgcatctgtgccc
ttgcctgctcccttcttcaagcagacaactactcccgccactgctcccaccacaactgcc
ccgctcttcactggcctggccagcgccacctctgctgtggctcccatcacctctgccagt
ccatccacagactctgcttcgaagcctgcgtttggctttggcataaacagtgtgagcagc
agcagtgtgagtaccacgaccagcaccgccactgccgcctcacagcctttcctcttcggg
gcgccccaggcctctgctgccagcttcaccccggccatgggctccatattccagtttggc
aaacctcctgccttgcccacaaccaccacagtcaccaccttcagccagtccctgcccact
gccgtgccaacggccaccagcagcagcgctgccgactttagtggttttggcagcaccctc
gccacctccgccccggccaccagcagccagcccactctgacgttcagtaacacgagcacc
cccacgttcaacattccctttggctcaagcgccaagtccccgctcccatcatatccggga
gccaacccccagcccgcatttggggccgctgaggggcagccaccgggggccgccaagcca
gcccttacccccagctttggcagctctttcacttttggaaactctgcagccccggccccg
gctactgcacccacacctgcacctgcgtccacgatcaagatcgtgcctgcgcacgtgcct
acgcccatccagcctacctttggcggtgccacgcactcggcgtttggattgaaagccacg
gcttccgccttcggcgctcccgccagctcacagcccgcctttggcggctccactgctgtc
ttctccttcggtgcagccaccagctccggctttggagccaccacccagaccgccagcagc
gggagcagcagctcggtgtttggcagcacaacaccatcacccttcacgtttgggggttcg
gcagcccccgctggcagtgggagctttgggatcaacgtggccaccccaggctccagcgcc
accaccggagctttcagctttggagcaggacagagtgggagcacagccacctccaccccc
ttcacagggggcttaggtcagaacgccctgggcaccaccggccagagcacaccgtttgcc
ttcaacgtgggcagcacaactgagagcaaacctgtgtttggaggcaccgccacccccacc
tttggtcagaacacccctgcgcctggagtgggcacatcgggcagcagcctctcctttggg
gcatcttcagcacccgcccaaggctttgttggtgttggaccgttcggatcggcggcccct
tcattttccattggtgcgggatccaagaccccaggggctcgacagcgactgcaggcccga
aggcagcacacccgcaaaaagtag

DBGET integrated database retrieval system