KEGG   Homo sapiens (human): 10013Help
Entry
10013             CDS       T01001                                 

Gene name
HDAC6, CPBHM, HD6, PPP1R90
Definition
histone deacetylase 6 (EC:3.5.1.98)
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Drug target
Vorinostat: 
Romidepsin: 
Panobinostat: 
Valproic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    10013 (HDAC6)
  Substance dependence
   05034 Alcoholism
    10013 (HDAC6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     10013 (HDAC6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10013 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.23
AA seq 1215 aa AA seqDB search
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaccggccaggattccaccacaaccaggcagcgaagaagtaggcagaacccc
cagtcgccccctcaggactccagtgtcacttcgaagcgaaatattaaaaagggagccgtt
ccccgctctatccccaatctagcggaggtaaagaagaaaggcaaaatgaagaagctcggc
caagcaatggaagaagacctaatcgtgggactgcaagggatggatctgaaccttgaggct
gaagcactggctggcactggcttggtgttggatgagcagttaaatgaattccattgcctc
tgggatgacagcttcccggaaggccctgagcggctccatgccatcaaggagcaactgatc
caggagggcctcctagatcgctgcgtgtcctttcaggcccggtttgctgaaaaggaagag
ctgatgttggttcacagcctagaatatattgatctgatggaaacaacccagtacatgaat
gagggagaactccgtgtcctagcagacacctacgactcagtttatctgcatccgaactca
tactcctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgcggtcctgggg
gctgagatccggaatggcatggccatcattaggcctcctggacatcacgcccagcacagt
cttatggatggctattgcatgttcaaccacgtggctgtggcagcccgctatgctcaacag
aaacaccgcatccggagggtccttatcgtagattgggatgtgcaccacggtcaaggaaca
cagttcaccttcgaccaggaccccagtgtcctctatttctccatccaccgctacgagcag
ggtaggttctggccccacctgaaggcctctaactggtccaccacaggtttcggccaaggc
caaggatataccatcaatgtgccttggaaccaggtggggatgcgggatgctgactacatt
gctgctttcctgcacgtcctgctgccagtcgccctcgagttccagcctcagctggtcctg
gtggctgctggatttgatgccctgcaaggggaccccaagggtgagatggccgccactccg
gcagggttcgcccagctaacccacctgctcatgggtctggcaggaggcaagctgatcctg
tctctggagggtggctacaacctccgcgccctggctgaaggcgtcagtgcttcgctccac
acccttctgggagacccttgccccatgctggagtcacctggtgccccctgccggagtgcc
caggcttcagtttcctgtgctctggaagcccttgagcccttctgggaggttcttgtgaga
tcaactgagaccgtggagagggacaacatggaggaggacaatgtagaggagagcgaggag
gaaggaccctgggagccccctgtgctcccaatcctgacatggccagtgctacagtctcgc
acagggctggtctatgaccaaaatatgatgaatcactgcaacttgtgggacagccaccac
cctgaggtaccccagcgcatcttgcggatcatgtgccgtctggaggagctgggccttgcc
gggcgctgcctcaccctgacaccgcgccctgccacagaggctgagctgctcacctgtcac
agtgctgagtacgtgggtcatctccgggccacagagaaaatgaaaacccgggagctgcac
cgtgagagttccaactttgactccatctatatctgccccagtaccttcgcctgtgcacag
cttgccactggcgctgcctgccgcctggtggaggctgtgctctcaggagaggttctgaat
ggtgctgctgtggtgcgtcccccaggacaccacgcagagcaggatgcagcttgcggtttt
tgctttttcaactctgtggctgtggctgctcgccatgcccagactatcagtgggcatgcc
ctacggatcctgattgtggattgggatgtccaccacggtaatggaactcagcacatgttt
gaggatgaccccagtgtgctatatgtgtccctgcaccgctatgatcatggcaccttcttc
cccatgggggatgagggtgccagcagccagatcggccgggctgcgggcacaggcttcacc
gtcaacgtggcatggaacgggccccgcatgggtgatgctgactacctagctgcctggcat
cgcctggtgcttcccattgcctacgagtttaacccagaactggtgctggtctcagctggc
tttgatgctgcacggggggatccgctggggggctgccaggtgtcacctgagggttatgcc
cacctcacccacctgctgatgggccttgccagtggccgcattatccttatcctagagggt
ggctataacctgacatccatctcagagtccatggctgcctgcactcgctccctccttgga
gacccaccacccctgctgaccctgccacggcccccactatcaggggccctggcctcaatc
actgagaccatccaagtccatcgcagatactggcgcagcttacgggtcatgaaggtagaa
gacagagaaggaccctccagttctaagttggtcaccaagaaggcaccccaaccagccaaa
cctaggttagctgagcggatgaccacacgagaaaagaaggttctggaagcaggcatgggg
aaagtcacctcggcatcatttggggaagagtccactccaggccagactaactcagagaca
gctgtggtggccctcactcaggaccagccctcagaggcagccacagggggagccactctg
gcccagaccatttctgaggcagccattgggggagccatgctgggccagaccacctcagag
gaggctgtcgggggagccactccggaccagaccacctcagaggagactgtgggaggagcc
attctggaccagaccacctcagaggatgctgttgggggagccacgctgggccagactacc
tcagaggaggctgtaggaggagctacactggcccagaccacctcggaggcagccatggag
ggagccacactggaccagactacgtcagaggaggctccagggggcaccgagctgatccaa
actcctctagcctcgagcacagaccaccagacccccccaacctcacctgtgcagggaact
acaccccagatatctcccagtacactgattgggagtctcaggaccttggagctaggcagc
gaatctcagggggcctcagaatctcaggccccaggagaggagaacctactaggagaggca
gctggaggtcaggacatggctgattcgatgctgatgcagggatctaggggcctcactgat
caggccatattttatgctgtgacaccactgccctggtgtccccatttggtggcagtatgc
cccatacctgcagcaggcctagacgtgacccaaccttgtggggactgtggaacaatccaa
gagaattgggtgtgtctctcttgctatcaggtctactgtggtcgttacatcaatggccac
atgctccaacaccatggaaattctggacacccgctggtcctcagctacatcgacctgtca
gcctggtgttactactgtcaggcctatgtccaccaccaggctctcctagatgtgaagaac
atcgcccaccagaacaagtttggggaggatatgccccacccacactaa

DBGET integrated database retrieval system