KEGG   Homo sapiens (human): 100133941Help
Entry
100133941         CDS       T01001                                 

Gene name
CD24, CD24A
Definition
(RefSeq) CD24 molecule
  KO
K06469  
CD24 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    100133941 (CD24)
Cell adhesion molecules and their ligands [BR:hsa04516]
 3. Selectin Family
  SELP; selectin, platelet [KO:K06496]
   100133941 (CD24)
Cellular antigens [BR:hsa04090]
 Proteins
  100133941 (CD24)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  100133941 (CD24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P25063(Tbio)
UniProt: 
Position
6q21
AA seq 80 aa AA seqDB search
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGG
ALQSTASLFVVSLSLLHLYS
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagcaatggtggccaggctcgggctggggctgctgctgctggcactgctccta
cccacgcagatttattccagtgaaacaacaactggaacttcaagtaactcctcccagagt
acttccaactctgggttggccccaaatccaactaatgccaccaccaaggcggctggtggt
gccctgcagtcaacagccagtctcttcgtggtctcactctctcttctgcatctctactct
taa

DBGET integrated database retrieval system