KEGG   Homo sapiens (human): 100133941Help
Entry
100133941         CDS       T01001                                 

Gene name
CD24, CD24A
Definition
(RefSeq) CD24 molecule
  KO
K06469  CD24 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    100133941 (CD24)
CD molecules [BR:hsa04090]
 Proteins
  100133941 (CD24)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  100133941 (CD24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD24 DUF1180
Motif
Other DBs
NCBI-GeneID: 100133941
NCBI-ProteinID: NP_001278666
OMIM: 600074
HGNC: 1645
Ensembl: ENSG00000272398
Vega: OTTHUMG00000188439
Pharos: P25063(Tbio)
UniProt: P25063
Position
6q21
AA seq 80 aa AA seqDB search
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGG
ALQSTASLFVVSLSLLHLYS
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagcaatggtggccaggctcgggctggggctgctgctgctggcactgctccta
cccacgcagatttattccagtgaaacaacaactggaacttcaagtaactcctcccagagt
acttccaactctgggttggccccaaatccaactaatgccaccaccaaggcggctggtggt
gccctgcagtcaacagccagtctcttcgtggtctcactctctcttctgcatctctactct
taa

DBGET integrated database retrieval system