KEGG   Homo sapiens (human): 10014Help
Entry
10014             CDS       T01001                                 

Gene name
HDAC5, HD5, NY-CO-9
Definition
(RefSeq) histone deacetylase 5 (EC:3.5.1.98)
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Drug target
Romidepsin: 
Panobinostat [DG:DG01403]: 
Belinostat: 
Valproic acid [DG:DG00849]: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    10014 (HDAC5)
  Substance dependence
   05034 Alcoholism
    10014 (HDAC5)
  Infectious diseases
   05169 Epstein-Barr virus infection
    10014 (HDAC5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     10014 (HDAC5)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     10014 (HDAC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21
AA seq 1122 aa AA seqDB search
MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELR
GALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
QEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIAS
TEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKL
PLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
TGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQ
FSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATS
MRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGE
LPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
CIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQ
SSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQE
TGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLP
CGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNF
FPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVS
AGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVS
ALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGET
EEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcccaacgagtcggatgggatgtcaggtcgggaaccatccttggaaatcctg
ccgcggacttctctgcacagcatccctgtgacagtggaggtgaagccggtgctgccaaga
gccatgcccagttccatggggggtgggggtggaggcagccccagccctgtggagctacgg
ggggctctggtgggctctgtggaccccacactgcgggagcagcaactgcagcaggagctc
ctggcgctcaagcagcagcagcagctgcagaagcagctcctgttcgctgagttccagaaa
cagcatgaccacctgacaaggcagcatgaggtccagctgcagaagcacctcaagcagcag
caggagatgctggcagccaagcagcagcaggagatgctggcagccaagcggcagcaggag
ctggagcagcagcggcagcgggagcagcagcggcaggaagagctggagaagcagcggctg
gagcagcagctgctcatcctgcggaacaaggagaagagcaaagagagtgccattgccagc
actgaggtaaagctgaggctccaggaattcctcttgtcgaagtcaaaggagcccacacca
ggcggcctcaaccattccctcccacagcaccccaaatgctggggagcccaccatgcttct
ttggaccagagttcccctccccagagcggcccccctgggacgcctccctcctacaaactg
cctttgcctgggccctacgacagtcgagacgacttccccctccgcaaaacagcctctgaa
cccaacttgaaagtgcgttcaaggctaaaacagaaggtggctgagcggagaagcagtccc
ctcctgcgtcgcaaggatgggactgttattagcacctttaagaagagagctgttgagatc
acaggtgccgggcctggggcgtcgtccgtgtgtaacagcgcacccggctccggccccagc
tctcccaacagctcccacagcaccatcgctgagaatggctttactggctcagtccccaac
atccccactgagatgctccctcagcaccgagccctccctctggacagctcccccaaccag
ttcagcctctacacgtctccttctctgcccaacatctccctagggctgcaggccacggtc
actgtcaccaactcacacctcactgcctccccgaagctgtcgacacagcaggaggccgag
aggcaggccctccagtccctgcggcagggtggcacgctgaccggcaagttcatgagcaca
tcctctattcctggctgcctgctgggcgtggcactggagggcgacgggagcccccacggg
catgcctccctgctgcagcatgtgctgttgctggagcaggcccggcagcagagcaccctc
attgctgtgccactccacgggcagtccccactagtgacgggtgaacgtgtggccaccagc
atgcggacggtaggcaagctcccgcggcatcggcccctgagccgcactcagtcctcaccg
ctgccgcagagtccccaggccctgcagcagctggtcatgcaacaacagcaccagcagttc
ctggagaagcagaagcagcagcagctacagctgggcaagatcctcaccaagacaggggag
ctgcccaggcagcccaccacccaccctgaggagacagaggaggagctgacggagcagcag
gaggtcttgctgggggagggagccctgaccatgccccgggagggctccacagagagtgag
agcacacaggaagacctggaggaggaggacgaggaagacgatggggaggaggaggaggat
tgcatccaggttaaggacgaggagggcgagagtggtgctgaggaggggcccgacttggag
gagcctggtgctggatacaaaaaactgttctcagatgcccagccgctgcagcctttgcag
gtgtaccaggcgcccctcagcctggccactgtgccccaccaggccctgggccgtacccag
tcctcccctgctgcccctgggggcatgaagagccccccagaccagcccgtcaagcacctc
ttcaccacaggtgtggtctacgacacgttcatgctaaagcaccagtgcatgtgcgggaac
acacacgtgcaccctgagcatgctggccggatccagagcatctggtcccggctgcaggag
acaggcctgcttagcaagtgcgagcggatccgaggtcgcaaagccacgctagatgagatc
cagacagtgcactctgaataccacaccctgctctatgggaccagtcccctcaaccggcag
aagctagacagcaagaagttgctcggccccatcagccagaagatgtatgctgtgctgcct
tgtgggggcatcggggtggacagtgacaccgtgtggaatgagatgcactcctccagtgct
gtgcgcatggcagtgggctgcctgctggagctggccttcaaggtggctgcaggagagctc
aagaatggatttgccatcatccggcccccaggacaccacgccgaggaatccacagccatg
ggattctgcttcttcaactctgtagccatcaccgcaaaactcctacagcagaagttgaac
gtgggcaaggtcctcatcgtggactgggacattcaccatggcaatggcacccagcaggcg
ttctacaatgacccctctgtgctctacatctctctgcatcgctatgacaacgggaacttc
tttccaggctctggggctcctgaagaggttggtggaggaccaggcgtggggtacaatgtg
aacgtggcatggacaggaggtgtggacccccccattggagacgtggagtaccttacagcc
ttcaggacagtggtgatgcccattgcccacgagttctcacctgatgtggtcctagtctcc
gccgggtttgatgctgttgaaggacatctgtctcctctgggtggctactctgtcaccgcc
agatgttttggccacttgaccaggcagctgatgaccctggcagggggccgggtggtgctg
gccctggagggaggccatgacttgaccgccatctgtgatgcctctgaggcttgtgtctcg
gctctgctcagtgtagagctgcagcccttggatgaggcagtcttgcagcaaaagcccaac
atcaacgcagtggccacgctagagaaagtcatcgagatccagagcaaacactggagctgt
gtgcagaagttcgccgctggtctgggccggtccctgcgagaggcccaagcaggtgagacc
gaggaggccgagactgtgagcgccatggccttgctgtcggtgggggccgagcaggcccag
gctgcggcagcccgggaacacagccccaggccggcagaggagcccatggagcaggagcct
gccctgtga

DBGET integrated database retrieval system