KEGG   Homo sapiens (human): 10018Help
Entry
10018             CDS       T01001                                 

Gene name
BCL2L11, BAM, BIM, BOD
Definition
(RefSeq) BCL2 like 11
  KO
K16341  
Bcl-2-like protein 11
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
FoxO signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Apoptosis - multiple species
Non-alcoholic fatty liver disease (NAFLD)
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    10018 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    10018 (BCL2L11)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    10018 (BCL2L11)
   04215 Apoptosis - multiple species
    10018 (BCL2L11)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    10018 (BCL2L11)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    10018 (BCL2L11)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    10018 (BCL2L11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q13
AA seq 198 aa AA seqDB search
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
MVILRLLRYIVRLVWRMH
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcaaccttctgatgtaagttctgagtgtgaccgagaaggtagacaattgcag
cctgcggagaggcctccccagctcagacctggggcccctacctccctacagacagagcca
caaggtaatcctgaaggcaatcacggaggtgaaggggacagctgcccccacggcagccct
cagggcccgctggccccacctgccagccctggcccttttgctaccagatccccgcttttc
atctttatgagaagatcctccctgctgtctcgatcctccagtgggtatttctcttttgac
acagacaggagcccagcacccatgagttgtgacaaatcaacacaaaccccaagtcctcct
tgccaggccttcaaccactatctcagtgcaatggcttccatgaggcaggctgaacctgca
gatatgcgcccagagatatggatcgcccaagagttgcggcgtattggagacgagtttaac
gcttactatgcaaggagggtatttttgaataattaccaagcagccgaagaccacccacga
atggttatcttacgactgttacgttacattgtccgcctggtgtggagaatgcattga

DBGET integrated database retrieval system