KEGG   Homo sapiens (human): 10019Help
Entry
10019             CDS       T01001                                 

Gene name
SH2B3, IDDM20, LNK
Definition
(RefSeq) SH2B adaptor protein 3
  KO
K12459  SH2B adaptor protein 1/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
Disease
H00408  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    10019 (SH2B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phe_ZIP SH2 PH
Motif
Other DBs
NCBI-GeneID: 10019
NCBI-ProteinID: NP_005466
OMIM: 605093
HGNC: 29605
Ensembl: ENSG00000111252
Vega: OTTHUMG00000169550
Pharos: Q9UQQ2(Tbio)
UniProt: Q9UQQ2 Q59H48
Position
12q24.12
AA seq 575 aa AA seqDB search
MNGPALQPSSPSSAPSASPAAAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRA
ELVSLQFTDLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARS
SEELAPPRPPGPCSFQHFRRSLRHIFRRRSAGELPAAHTAAAPGTPGEAAETPARPGLAK
KFLPWSLAREPPPEALKEAVLRYSLADEASMDSGARWQRGRLALRRAPGPDGPDRVLELF
DPPKSSRPKLQAACSSIQEVRWCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMA
ELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLS
CYPWFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTE
RGQCRVQHLHFPSVVDMLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLFPFS
LPHWDSESLPHWGSELGLPHLSSSGCPRGLSPEGLPGRSSPPEQIFHLVPSPEELANSLQ
HLEHEPVNRARDSDYEMDSSSRSHLRAIDNQYTPL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggcctgccctgcagccctcctcgccctcttccgcgccctcagcctccccggcg
gcggccccgcggggctggagcgagttctgtgagttgcacgccgtagcggcggcccgggag
ctggcccgccagtactggctgttcgcccgggagcatccgcagcacgcgccgctgcgcgcc
gagctggtgtcgctgcagttcaccgacctcttccagcgctacttctgccgcgaggtgcgc
gacggacgggcgccgggccgcgactaccgggacacaggccgtgggcccccagccaaggcc
gaggcgtccccggagccaggccccggccccgccgcccctggcctgcccaaggcccgcagc
tctgaggagctggccccgccgcggccgcccgggccctgctccttccagcactttcgccgc
agcctccgccacatcttccgccgccgctcggccggggagctgccagcggcccacaccgct
gccgcccccgggacccccggagaggctgctgagacccccgcccggcctggcctggccaag
aagttcctgccctggagcctggcccgggagccgccacccgaggcgctgaaggaggcggtg
ctgcgctacagcctggccgacgaggcctccatggacagcggggcacgctggcagcgcggg
aggctggcgctgcgccgggccccgggccccgatggccccgaccgcgtgctggagctcttc
gacccacccaagagttcaaggcccaagctacaagcagcttgctccagcatccaggaggtc
cggtggtgcacacggcttgagatgcctgacaacctttacacctttgtgctgaaggtgaag
gaccggacagacatcatctttgaggtgggagacgagcagcagctgaattcatggatggct
gagctctcggagtgcacaggccgagggctggagagcacagaagcagagatgcatattccc
tcagccctagagcctagcacgtccagctccccaaggggcagcacagattcccttaaccaa
ggtgcttctcctggggggctgctggacccggcctgccagaagacggaccatttcctgtcc
tgctacccctggttccacggccccatctccagagtgaaagcagctcagctggttcagctg
cagggccctgatgctcatggagtgttcctggtgcggcagagcgagacgcggcgtggggaa
tacgtgctcactttcaactttcaggggatagccaagcacctgcgcctgtcgctgacagag
cggggccagtgccgtgtgcagcacctccactttccctcggtcgtggacatgctccaccac
ttccagcgctcgcccatcccactcgagtgcggcgccgcctgtgatgtccggctctccagc
tacgtggtagtcgtctcccaaccaccaggttcctgcaacacggtcctcttccctttctcc
cttcctcactgggattcagagtcccttcctcactggggttcagagttgggccttccccac
cttagttcttctggctgtccccgggggctcagcccagagggtctcccagggcgatcctca
ccccccgagcagatcttccacctggtgccttcgcccgaagaactggccaacagcctgcag
cacctggagcatgagcctgtgaatcgagcccgggactcggactacgaaatggactcatcc
tcccggagccacctgcgggccatagacaatcagtacacacctctctga

DBGET integrated database retrieval system