KEGG   Homo sapiens (human): 1002Help
Entry
1002              CDS       T01001                                 

Gene name
CDH4, CAD4, R-CAD, RCAD
Definition
(RefSeq) cadherin 4, type 1, R-cadherin (retinal)
  KO
K06797  
cadherin 4, type 1, R-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1002 (CDH4)
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDH2; cadherin 2, type 1, N-cadherin [KO:K06736]
     1002 (CDH4)
    CDH4; cadherin 4, type 1, R-cadherin [KO:K06797]
     1002 (CDH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Position
20q13.3
AA seq 879 aa AA seqDB search
MNGSCDFILSASFLPCFKEVKFSSCVGTKGTQYETNSMDFKVGADGTVFATRELQVPSEQ
VAFTVTAWDSQTAEKWDAVVRLLVAQTSSPHSGHKPQKGKKVVALDPSPPPKDTLLPWPQ
HQNANGLRRRKRDWVIPPINVPENSRGPFPQQLVRIRSDKDNDIPIRYSITGVGADQPPM
EVFSIDSMSGRMYVTRPMDREEHASYHLRAHAVDMNGNKVENPIDLYIYVIDMNDNRPEF
INQVYNGSVDEGSKPGTYVMTVTANDADDSTTANGMVRYRIVTQTPQSPSQNMFTINSET
GDIVTVAAGLDREKVQQYTVIVQATDMEGNLNYGLSNTATAIITVTDVNDNPPEFTASTF
AGEVPENRVETVVANLTVMDRDQPHSPNWNAVYRIISGDPSGHFSVRTDPVTNEGMVTVV
KAVDYELNRAFMLTVMVSNQAPLASGIQMSFQSTAGVTISIMDINEAPYFPSNHKLIRLE
EGVPPGTVLTTFSAVDPDRFMQQAVRYSKLSDPASWLHINATNGQITTAAVLDRESLYTK
NNVYEATFLAADNGIPPASGTGTLQIYLIDINDNAPELLPKEAQICEKPNLNAINITAAD
ADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGN
PPLSNTSIIKVKVCPCDDNGDCTTIGAVAAAGLGTGAIVAILICILILLTMVLLFVMWMK
RREKERHTKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPEAMGHVPSKAPGVR
RVDERPVGAEPQYPIRPMVPHPGDIGDFINEGLRAADNDPTAPPYDSLLVFDYEGSGSTA
GSVSSLNSSSSGDQDYDYLNDWGPRFKKLADMYGGGEED
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagctgtgacttcattctcagcgcctcctttctaccctgctttaaagaagtc
aagttcagcagctgtgtggggaccaaggggacacaatatgagaccaacagcatggacttc
aaagttggggcagatgggacagtcttcgccacccgggagctgcaggtcccctccgagcag
gtggcgttcacggtgactgcatgggacagccagacagcagagaaatgggacgccgtggtg
cggttgctggtggcccagacctcgtccccgcactctggacacaagccgcagaaaggaaag
aaggtcgtggctctggacccctctccgcctccgaaggacaccctgctgccgtggccccag
caccagaacgccaacgggctgaggcggcgcaaacgggactgggtcatcccgcccatcaac
gtgcccgagaactcgcgcgggcccttcccgcagcagctcgtgaggatccggtccgacaaa
gacaatgacatccccatccggtacagcatcacgggagtgggcgccgaccagccccccatg
gaggtcttcagcattgactccatgtccggccggatgtacgtcacaaggcccatggaccgg
gaggagcacgcctcttaccacctccgagcccacgctgtggacatgaatggcaacaaggtg
gagaaccccatcgacctgtacatctacgtcatcgacatgaatgacaaccgccctgagttc
atcaaccaggtctacaacggctccgtggacgagggctccaagccaggcacctacgtgatg
accgtcacggccaacgatgctgacgacagcaccacggccaacgggatggtgcggtaccgg
atcgtgacccagaccccacagagcccgtcccagaatatgttcaccatcaacagcgagact
ggagatatcgtcacagtggcggctggcctggaccgagagaaagttcagcagtacacagtc
atcgttcaggccacagatatggaaggaaatctcaactatggcctctcaaacacagccaca
gccatcatcacggtgacagatgtgaatgacaacccgccagaatttaccgccagcacgttt
gcaggggaggtccccgaaaaccgcgtggagaccgtggtcgcaaacctcacggtgatggac
cgagatcagccccactctccaaactggaatgccgtttaccgcatcatcagtggggatcca
tccgggcacttcagcgtccgcacagaccccgtaaccaacgagggcatggtcaccgtggtg
aaggcagtcgactacgagctcaacagagctttcatgctgacagtgatggtgtccaaccag
gcgcccctggccagcggaatccagatgtccttccagtccacggcaggggtgaccatctcc
atcatggacatcaacgaggctccctacttcccctcaaaccacaagctgatccgcctggag
gagggcgtgccccccggcaccgtgctgaccacgttttcagctgtggaccctgaccggttc
atgcagcaggctgtgagatactcaaagctgtcagacccagcgagctggctgcacatcaat
gccaccaacggccagatcaccacggcggcagtgctggaccgtgagtccctctacaccaaa
aacaacgtctacgaggccaccttcctggcagctgacaatgggatacccccggccagcggc
accgggaccctccagatctatctcattgacatcaacgacaacgcccctgagctgctgccc
aaggaggcgcagatctgcgagaagcccaacctgaacgccatcaacatcacggcggccgac
gctgacgtcgaccccaacatcggcccctacgtcttcgagctgccctttgtcccggcggcc
gtgcggaagaactggaccatcacccgcctgaacggtgactatgcccaactcagcttgcgc
atcctgtacctggaggccgggatgtatgacgtccccatcatcgtcacagactctggaaac
cctcccctgtccaacacgtccatcatcaaagtcaaggtgtgcccatgtgatgacaacggg
gactgcaccaccattggcgcagtggcagcggctggtctgggcaccggtgccatcgtggcc
atcctcatctgcatcctcatcctgctgaccatggtcctgctgtttgtcatgtggatgaag
cggcgagagaaggagcgccacacgaagcagctgctcattgaccccgaggacgacgtccgc
gacaacatcctcaagtatgacgaggaaggcggtggcgaggaggaccaggactacgacctc
agccagctgcagcagccggaagccatggggcacgtgccaagcaaagcccctggcgtgcgt
cgcgtggatgagcggccggtgggcgctgagccccagtacccgatcaggcccatggtgccg
cacccaggcgacatcggtgacttcatcaatgagggactccgcgctgctgacaacgacccc
acggcacccccctatgactccctgctggtcttcgactacgaggggagcggctccaccgca
ggctccgtcagctccctgaactcatccagttccggggaccaagactacgattacctcaac
gactgggggcccagattcaagaagctggcggacatgtatggaggtggtgaagaggattga

DBGET integrated database retrieval system