KEGG   Homo sapiens (human): 10023Help
Entry
10023             CDS       T01001                                 

Gene name
FRAT1
Definition
(RefSeq) FRAT1, WNT signaling pathway regulator
  KO
K03069  
frequently rearranged in advanced T-cell lymphomas 1
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Pathways in cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Network
N00056  
Wnt signaling pathway
N00059  
FZD7-overexpression to Wnt signaling pathway
N00060  
LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    10023 (FRAT1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10023 (FRAT1)
   05225 Hepatocellular carcinoma
    10023 (FRAT1)
   05226 Gastric cancer
    10023 (FRAT1)
   05224 Breast cancer
    10023 (FRAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92837(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.1
AA seq 279 aa AA seqDB search
MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSP
ASPCGPPGAPLRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGR
VRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASR
RLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGPL
SAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgccggagggaggaggaagaggaagccggcgaggaggcggagggggaggaagag
gaggaggacagcttcctcctactgcagcagtcagtggcgctgggcagctcgggcgaggtg
gaccggctggtggcccagatcggcgagacgctgcagctggacgcggcgcagcacagcccg
gcctcgccgtgcgggcccccgggggcgccgctgcgggccccggggcccctggctgcggcg
gtgccggcggacaaggccaggtccccggcggtgccgctgctgctgccgcccgcgttggcg
gagactgtgggcccggcgccccctggggtcctgcgctgcgccctgggggaccgcggccgc
gtgcggggccgcgctgcgccctactgcgtggccgagctcgccacaggccccagcgcgctg
tccccactgccccctcaggccgaccttgatgggcctccgggagctggcaagcagggcatc
ccgcagccgctgtcgggtccgtgccggcgaggatggctccggggcgccgccgcctcccgc
cgcctgcagcagcgacgcgggtcccaaccagaaacccgcacaggcgacgacgacccgcac
cggcttctgcagcagctagtgctctctggaaacctcatcaaggaggccgtgcgaaggctt
cattcgcgacggctgcagttacgtgcaaagcttccccaacgcccgctcctgggacctctg
tcggccccggtgcatgaacccccttcgcctcgcagccctcgcgcggcctgcagtgaccct
ggcgcctccgggagggcgcagctcagaactggcgacggcgttcttgtgcctggcagctaa

DBGET integrated database retrieval system