KEGG   Homo sapiens (human): 10023Help
Entry
10023             CDS       T01001                                 

Gene name
FRAT1
Definition
frequently rearranged in advanced T-cell lymphomas
Orthology
K03069  
frequently rearranged in advanced T-cell lymphomas 1
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.1
AA seq 279 aa AA seqDB search
MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSP
ASPCGPPGAPLRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGR
VRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASR
RLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGPL
SAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgccggagggaggaggaagaggaagccggcgaggaggcggagggggaggaagag
gaggaggacagcttcctcctactgcagcagtcagtggcgctgggcagctcgggcgaggtg
gaccggctggtggcccagatcggcgagacgctgcagctggacgcggcgcagcacagcccg
gcctcgccgtgcgggcccccgggggcgccgctgcgggccccggggcccctggctgcggcg
gtgccggcggacaaggccaggtccccggcggtgccgctgctgctgccgcccgcgttggcg
gagactgtgggcccggcgccccctggggtcctgcgctgcgccctgggggaccgcggccgc
gtgcggggccgcgctgcgccctactgcgtggccgagctcgccacaggccccagcgcgctg
tccccactgccccctcaggccgaccttgatgggcctccgggagctggcaagcagggcatc
ccgcagccgctgtcgggtccgtgccggcgaggatggctccggggcgccgccgcctcccgc
cgcctgcagcagcgacgcgggtcccaaccagaaacccgcacaggcgacgacgacccgcac
cggcttctgcagcagctagtgctctctggaaacctcatcaaggaggccgtgcgaaggctt
cattcgcgacggctgcagttacgtgcaaagcttccccaacgcccgctcctgggacctctg
tcggccccggtgcatgaacccccttcgcctcgcagccctcgcgcggcctgcagtgaccct
ggcgcctccgggagggcgcagctcagaactggcgacggcgttcttgtgcctggcagctaa

DBGET integrated database retrieval system