KEGG   Homo sapiens (human): 100289087Help
Entry
100289087         CDS       T01001                                 

Gene name
TSPY10
Definition
(RefSeq) testis specific protein, Y-linked 10
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
Yp11.2
AA seq 308 aa AA seqDB search
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALG
EEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELE
PVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDM
LSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPD
YEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTET
SGDSQLLS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctgagggctcgctgacctaccgggtgccagagaggctgcggcagggtttctgt
ggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttc
aggatggaggctgtacaggagggggcggccggggtggagagtgagcaggcggctttgggg
gaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggag
gagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccct
gggcccatgaccccagagtctgcactggaggagctgctggccgttcaggtggagctggag
ccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggagg
cgcaagccccacctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggcc
aatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatg
ctgagctacatggtcagcctggaggtggaagaagagaagcatcctgttcatctctgcaag
atcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatat
ctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatccggat
tatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactgg
ttctctgaccacaacttcgcaggatctaacaagattgctgagatcctatgtaaggacctg
tggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacg
tcaggggactcccagttgttgagttga

DBGET integrated database retrieval system