KEGG   Homo sapiens (human): 100289462Help
Entry
100289462         CDS       T01001                                 

Gene name
DEFB4B, DEFB4P
Definition
(RefSeq) defensin beta 4B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p23.1
AA seq 64 aa AA seqDB search
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC
CKKP
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcttgtatctcctcttctcgttcctcttcatatttctgatgcctcttccaggt
gtttttggtggtataggcgatcctgttacctgccttaagagtggagccatatgtcatcca
gtcttttgccctagaaggtataaacaaattggcacctgtggtctccctggaacaaaatgc
tgcaaaaagccatga

DBGET integrated database retrieval system