KEGG   Homo sapiens (human): 1003Help
Entry
1003              CDS       T01001                                 

Gene name
CDH5, 7B4, CD144
Definition
cadherin 5, type 2 (vascular endothelium)
Orthology
K06533  
cadherin 5, type 2, VE-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1003 (CDH5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    1003 (CDH5)
Cellular antigens [BR:hsa04090]
 Proteins
  1003 (CDH5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 784 aa AA seqDB search
MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEK
NTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTA
VIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADD
PTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSG
TATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRG
DYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVI
INITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFA
KPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKY
GQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQA
VVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDV
SVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDG
DGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPRE
ELLY
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggctcatgatgctcctcgccacatcgggcgcctgcctgggcctgctggcagtg
gcagcagtggcagcagcaggtgctaaccctgcccaacgggacacccacagcctgctgccc
acccaccggcgccaaaagagagattggatttggaaccagatgcacattgatgaagagaaa
aacacctcacttccccatcatgtaggcaagatcaagtcaagcgtgagtcgcaagaatgcc
aagtacctgctcaaaggagaatatgtgggcaaggtcttccgggtcgatgcagagacagga
gacgtgttcgccattgagaggctggaccgggagaatatctcagagtaccacctcactgct
gtcattgtggacaaggacactggcgaaaacctggagactccttccagcttcaccatcaaa
gttcatgacgtgaacgacaactggcctgtgttcacgcatcggttgttcaatgcgtccgtg
cctgagtcgtcggctgtggggacctcagtcatctctgtgacagcagtggatgcagacgac
cccactgtgggagaccacgcctctgtcatgtaccaaatcctgaaggggaaagagtatttt
gccatcgataattctggacgtattatcacaataacgaaaagcttggaccgagagaagcag
gccaggtatgagatcgtggtggaagcgcgagatgcccagggcctccggggggactcgggc
acggccaccgtgctggtcactctgcaagacatcaatgacaacttccccttcttcacccag
accaagtacacatttgtcgtgcctgaagacacccgtgtgggcacctctgtgggctctctg
tttgttgaggacccagatgagccccagaaccggatgaccaagtacagcatcttgcggggc
gactaccaggacgctttcaccattgagacaaaccccgcccacaacgagggcatcatcaag
cccatgaagcctctggattatgaatacatccagcaatacagcttcatcgtcgaggccaca
gaccccaccatcgacctccgatacatgagccctcccgcgggaaacagagcccaggtcatt
atcaacatcacagatgtggacgagccccccattttccagcagcctttctaccacttccag
ctgaaggaaaaccagaagaagcctctgattggcacagtgctggccatggaccctgatgcg
gctaggcatagcattggatactccatccgcaggaccagtgacaagggccagttcttccga
gtcacaaaaaagggggacatttacaatgagaaagaactggacagagaagtctacccctgg
tataacctgactgtggaggccaaagaactggattccactggaacccccacaggaaaagaa
tccattgtgcaagtccacattgaagttttggatgagaatgacaatgccccggagtttgcc
aagccctaccagcccaaagtgtgtgagaacgctgtccatggccagctggtcctgcagatc
tccgcaatagacaaggacataacaccacgaaacgtgaagttcaaattcatcttgaatact
gagaacaactttaccctcacggataatcacgataacacggccaacatcacagtcaagtat
gggcagtttgaccgggagcataccaaggtccacttcctacccgtggtcatctcagacaat
gggatgccaagtcgcacgggcaccagcacgctgaccgtggccgtgtgcaagtgcaacgag
cagggcgagttcaccttctgcgaggatatggccgcccaggtgggcgtgagcatccaggca
gtggtagccatcttactctgcatcctcaccatcacagtgatcaccctgctcatcttcctg
cggcggcggctccggaagcaggcccgcgcgcacggcaagagcgtgccggagatccacgag
cagctggtcacctacgacgaggagggcggcggcgagatggacaccaccagctacgatgtg
tcggtgctcaactcggtgcgccgcggcggggccaagcccccgcggcccgcgctggacgcc
cggccttccctctatgcgcaggtgcagaagccaccgaggcacgcgcctggggcacacgga
gggcccggggagatggcagccatgatcgaggtgaagaaggacgaggcggaccacgacggc
gacggccccccctacgacacgctgcacatctacggctacgagggctccgagtccatagcc
gagtccctcagctccctgggcaccgactcatccgactctgacgtggattacgacttcctt
aacgactggggacccaggtttaagatgctggctgagctgtacggctcggacccccgggag
gagctgctgtattag

DBGET integrated database retrieval system