KEGG   Homo sapiens (human): 1003Help
Entry
1003              CDS       T01001                                 

Gene name
CDH5, 7B4, CD144
Definition
(RefSeq) cadherin 5
  KO
K06533  
cadherin 5, type 2, VE-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Leukocyte transendothelial migration
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1003 (CDH5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    1003 (CDH5)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    1003 (CDH5)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRB, PTPB; receptor-type tyrosine-protein phosphatase beta [KO:K05694]
     1003 (CDH5)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type II classic cadherins
    CDH5; cadherin 5, type 2, VE-cadherin [KO:K06533]
     1003 (CDH5)
Cellular antigens [BR:hsa04090]
 Proteins
  1003 (CDH5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P33151(Tbio)
UniProt: 
Position
16q21
AA seq 784 aa AA seqDB search
MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEK
NTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTA
VIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADD
PTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSG
TATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRG
DYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVI
INITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFA
KPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKY
GQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQA
VVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDV
SVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDG
DGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPRE
ELLY
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggctcatgatgctcctcgccacatcgggcgcctgcctgggcctgctggcagtg
gcagcagtggcagcagcaggtgctaaccctgcccaacgggacacccacagcctgctgccc
acccaccggcgccaaaagagagattggatttggaaccagatgcacattgatgaagagaaa
aacacctcacttccccatcatgtaggcaagatcaagtcaagcgtgagtcgcaagaatgcc
aagtacctgctcaaaggagaatatgtgggcaaggtcttccgggtcgatgcagagacagga
gacgtgttcgccattgagaggctggaccgggagaatatctcagagtaccacctcactgct
gtcattgtggacaaggacactggcgaaaacctggagactccttccagcttcaccatcaaa
gttcatgacgtgaacgacaactggcctgtgttcacgcatcggttgttcaatgcgtccgtg
cctgagtcgtcggctgtggggacctcagtcatctctgtgacagcagtggatgcagacgac
cccactgtgggagaccacgcctctgtcatgtaccaaatcctgaaggggaaagagtatttt
gccatcgataattctggacgtattatcacaataacgaaaagcttggaccgagagaagcag
gccaggtatgagatcgtggtggaagcgcgagatgcccagggcctccggggggactcgggc
acggccaccgtgctggtcactctgcaagacatcaatgacaacttccccttcttcacccag
accaagtacacatttgtcgtgcctgaagacacccgtgtgggcacctctgtgggctctctg
tttgttgaggacccagatgagccccagaaccggatgaccaagtacagcatcttgcggggc
gactaccaggacgctttcaccattgagacaaaccccgcccacaacgagggcatcatcaag
cccatgaagcctctggattatgaatacatccagcaatacagcttcatcgtcgaggccaca
gaccccaccatcgacctccgatacatgagccctcccgcgggaaacagagcccaggtcatt
atcaacatcacagatgtggacgagccccccattttccagcagcctttctaccacttccag
ctgaaggaaaaccagaagaagcctctgattggcacagtgctggccatggaccctgatgcg
gctaggcatagcattggatactccatccgcaggaccagtgacaagggccagttcttccga
gtcacaaaaaagggggacatttacaatgagaaagaactggacagagaagtctacccctgg
tataacctgactgtggaggccaaagaactggattccactggaacccccacaggaaaagaa
tccattgtgcaagtccacattgaagttttggatgagaatgacaatgccccggagtttgcc
aagccctaccagcccaaagtgtgtgagaacgctgtccatggccagctggtcctgcagatc
tccgcaatagacaaggacataacaccacgaaacgtgaagttcaaattcatcttgaatact
gagaacaactttaccctcacggataatcacgataacacggccaacatcacagtcaagtat
gggcagtttgaccgggagcataccaaggtccacttcctacccgtggtcatctcagacaat
gggatgccaagtcgcacgggcaccagcacgctgaccgtggccgtgtgcaagtgcaacgag
cagggcgagttcaccttctgcgaggatatggccgcccaggtgggcgtgagcatccaggca
gtggtagccatcttactctgcatcctcaccatcacagtgatcaccctgctcatcttcctg
cggcggcggctccggaagcaggcccgcgcgcacggcaagagcgtgccggagatccacgag
cagctggtcacctacgacgaggagggcggcggcgagatggacaccaccagctacgatgtg
tcggtgctcaactcggtgcgccgcggcggggccaagcccccgcggcccgcgctggacgcc
cggccttccctctatgcgcaggtgcagaagccaccgaggcacgcgcctggggcacacgga
gggcccggggagatggcagccatgatcgaggtgaagaaggacgaggcggaccacgacggc
gacggccccccctacgacacgctgcacatctacggctacgagggctccgagtccatagcc
gagtccctcagctccctgggcaccgactcatccgactctgacgtggattacgacttcctt
aacgactggggacccaggtttaagatgctggctgagctgtacggctcggacccccgggag
gagctgctgtattag

DBGET integrated database retrieval system