KEGG   Homo sapiens (human): 10038Help
Entry
10038             CDS       T01001                                 

Gene name
PARP2, ADPRT2, ADPRTL2, ADPRTL3, ARTD2, PARP-2, pADPRT-2
Definition
(RefSeq) poly(ADP-ribose) polymerase 2 (EC:2.4.2.30)
  KO
K10798  
poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Apoptosis
Module
BER complex
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    10038 (PARP2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    10038 (PARP2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     10038 (PARP2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    10038 (PARP2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    10038 (PARP2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     10038 (PARP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 583 aa AA seqDB search
MAARRRRSTGGGRARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMPVAGGKANKD
RTEDKQDGMPGRSWASKRVSESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLN
QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKF
LDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKPESQLDLRVQE
LIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALME
ACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQ
HYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDL
HNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLK
NTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGP
ASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNFLQLW
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcggcggcgacggagcaccggcggcggcagggcgagagcattaaatgaaagc
aaaagagttaataatggcaacacggctccagaagactcttcccctgccaagaaaactcgt
agatgccagagacaggagtcgaaaaagatgcctgtggctggaggaaaagctaataaggac
aggacagaagacaagcaagatggtatgccaggaaggtcatgggccagcaaaagggtctct
gaatctgtgaaggccttgctgttaaagggcaaagctcctgtggacccagagtgtacagcc
aaggtggggaaggctcatgtgtattgtgaaggaaatgatgtctatgatgtcatgctaaat
cagaccaatctccagttcaacaacaacaagtactatctgattcagctattagaagatgat
gcccagaggaacttcagtgtttggatgagatggggccgagttgggaaaatgggacagcac
agcctggtggcttgttcaggcaatctcaacaaggccaaggaaatctttcagaagaaattc
cttgacaaaacgaaaaacaattgggaagatcgagaaaagtttgagaaggtgcctggaaaa
tatgatatgctacagatggactatgccaccaatactcaggatgaagaggaaacaaagaaa
gaggaatctcttaaatctcccttgaagccagagtcacagctagatcttcgggtacaggag
ttaataaagttgatctgtaatgttcaggccatggaagaaatgatgatggaaatgaagtat
aataccaagaaagccccacttgggaagctgacagtggcacaaatcaaggcaggttaccag
tctcttaagaagattgaggattgtattcgggctggccagcatggacgagctctcatggaa
gcatgcaatgaattctacaccaggattccgcatgactttggactccgtactcctccacta
atccggacacagaaggaactgtcagaaaaaatacaattactagaggctttgggagacatt
gaaattgctattaagctggtgaaaacagagctacaaagcccagaacacccattggaccaa
cactatagaaacctacattgtgccttgcgcccccttgaccatgaaagttatgagttcaaa
gtgatttcccagtacctacaatctacccatgctcccacacacagcgactataccatgacc
ttgctggatttgtttgaagtggagaaggatggtgagaaagaagccttcagagaggacctt
cataacaggatgcttctatggcatggttccaggatgagtaactgggtgggaatcttgagc
catgggcttcgaattgccccacctgaagctcccatcacaggttacatgtttgggaaagga
atctactttgctgacatgtcttccaagagtgccaattactgctttgcctctcgcctaaag
aatacaggactgctgctcttatcagaggtagctctaggtcagtgtaatgaactactagag
gccaatcctaaggccgaaggattgcttcaaggtaaacatagcaccaaggggctgggcaag
atggctcccagttctgcccacttcgtcaccctgaatgggagtacagtgccattaggacca
gcaagtgacacaggaattctgaatccagatggttataccctcaactacaatgaatatatt
gtatataaccccaaccaggtccgtatgcggtaccttttaaaggttcagtttaatttcctt
cagctgtggtga

DBGET integrated database retrieval system