KEGG   Homo sapiens (human): 1004Help
Entry
1004              CDS       T01001                                 

Gene name
CDH6, CAD6, KCAD
Definition
(RefSeq) cadherin 6
  KO
K06798  
cadherin 6, type 2, K-cadherin
Organism
hsa  Homo sapiens (human)
Brite
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     1004 (CDH6)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type II classic cadherins
    CDH6; cadherin 6, type 2, K-cadherin [KO:K06798]
     1004 (CDH6)
    CDH7; cadherin 7, type 2 [KO:K06799]
     1004 (CDH6)
    CDH9; cadherin 9, type 2, T1-cadherin [KO:K06801]
     1004 (CDH6)
    CDH10; cadherin 10, type 2, T2-cadherin [KO:K06802]
     1004 (CDH6)
   Other classic cadherins
    CDH15, CDH3, CDH14; cadherin 15, M-cadherin [KO:K06809]
     1004 (CDH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p13.3
AA seq 790 aa AA seqDB search
MRTYRYFLLLFWVGQPYPTLSTPLSKRTSGFPAKKRALELSGNSKNELNRSKRSWMWNQF
FLLEEYTGSDYQYVGKLHSDQDRGDGSLKYILSGDGAGDLFIINENTGDIQATKRLDREE
KPVYILRAQAINRRTGRPVEPESEFIIKIHDINDNEPIFTKEVYTATVPEMSDVGTFVVQ
VTATDADDPTYGNSAKVVYSILQGQPYFSVESETGIIKTALLNMDRENREQYQVVIQAKD
MGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPESSPPGTPIGRIKASDADVGEN
AEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLY
LGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNPVKYS
VDRHTDMDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQSSRVPLYIKVLD
VNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQ
DNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSC
HAEALIHPTGLSTGALVAILLCIVILLVTVVLFAALRRQRKKEPLIISKEDIRDNIVSYN
DEGGGEEDTQAFDIGTLRNPEAIEDNKLRRDIVPEALFLPRRTPTARDNTDVRDFINQRL
KENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDADQDYDYLSDWGPRFKKLADM
YGGVDSDKDS
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgagaacttaccgctacttcttgctgctcttttgggtgggccagccctacccaactctc
tcaactccactatcaaagaggactagtggtttcccagcaaagaaaagggccctggagctc
tctggaaacagcaaaaatgagctgaaccgttcaaaaaggagctggatgtggaatcagttc
tttctcctggaggaatacacaggatccgattatcagtatgtgggcaagttacattcagac
caggatagaggagatggatcacttaaatatatcctttcaggagatggagcaggagatctc
ttcattattaatgaaaacacaggcgacatacaggccaccaagaggctggacagggaagaa
aaacccgtttacatccttcgagctcaagctataaacagaaggacagggagacccgtggag
cccgagtctgaattcatcatcaagatccatgacatcaatgacaatgaaccaatattcacc
aaggaggtttacacagccactgtccctgaaatgtctgatgtcggtacatttgttgtccaa
gtcactgcgacggatgcagatgatccaacatatgggaacagtgctaaagttgtctacagt
attctacagggacagccctatttttcagttgaatcagaaacaggtattatcaagacagct
ttgctcaacatggatcgagaaaacagggagcagtaccaagtggtgattcaagccaaggat
atgggcggccagatgggaggattatctgggaccaccaccgtgaacatcacactgactgat
gtcaacgacaaccctccccgattcccccagagtacataccagtttaaaactcctgaatct
tctccaccggggacaccaattggcagaatcaaagccagcgacgctgatgtgggagaaaat
gctgaaattgagtacagcatcacagacggtgaggggctggatatgtttgatgtcatcacc
gaccaggaaacccaggaagggattataactgtcaaaaagctcttggactttgaaaagaag
aaagtgtatacccttaaagtggaagcctccaatccttatgttgagccacgatttctctac
ttggggcctttcaaagattcagccacggttagaattgtggtggaggatgtagatgagcca
cctgtcttcagcaaactggcctacatcttacaaataagagaagatgctcagataaacacc
acaataggctccgtcacagcccaagatccagatgctgccaggaatcctgtcaagtactct
gtagatcgacacacagatatggacagaatattcaacattgattctggaaatggttcgatt
tttacatcgaaacttcttgaccgagaaacactgctatggcacaacattacagtgatagca
acagagatcaataatccaaagcaaagtagtcgagtacctctatatattaaagttctagat
gtcaatgacaacgccccagaatttgctgagttctatgaaacttttgtctgtgaaaaagca
aaggcagatcagttgattcagaccctgcatgctgttgacaaggatgacccttatagtgga
caccaattttcgttttccttggcccctgaagcagccagtggctcaaactttaccattcaa
gacaacaaagacaacacggcgggaatcttaactcggaaaaatggctataatagacacgag
atgagcacctatctcttgcctgtggtcatttcagacaacgactacccagttcaaagcagc
actgggacagtgactgtccgggtctgtgcatgtgaccaccacgggaacatgcaatcctgc
catgcggaggcgctcatccaccccacgggactgagcacgggggctctggttgccatcctt
ctgtgcatcgtgatcctactagtgacagtggtgctgtttgcagctctgaggcggcagcga
aaaaaagagcctttgatcatttccaaagaggacatcagagataacattgtcagttacaac
gacgaaggtggtggagaggaggacacccaggcttttgatatcggcaccctgaggaatcct
gaagccatagaggacaacaaattacgaagggacattgtgcccgaagcccttttcctaccc
cgacggactccaacagctcgcgacaacaccgatgtcagagatttcattaaccaaaggtta
aaggaaaatgacacggaccccactgccccgccatacgactccttggccacttacgcctat
gaaggcactggctccgtggcggattccctgagctcgctggagtcagtgaccacggatgca
gatcaagactatgattaccttagtgactggggacctcgattcaaaaagcttgcagatatg
tatggaggagtggacagtgacaaagactcctaa

DBGET integrated database retrieval system