KEGG   Homo sapiens (human): 1004Help
Entry
1004              CDS       T01001                                 

Gene name
CDH6, CAD6, KCAD
Definition
(RefSeq) cadherin 6
  KO
K06798  cadherin 6, type 2, K-cadherin
Organism
hsa  Homo sapiens (human)
Brite
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1004 (CDH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_3 ASFV_J13L Stevor 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 1004
NCBI-ProteinID: NP_004923
OMIM: 603007
HGNC: 1765
Ensembl: ENSG00000113361
Vega: OTTHUMG00000090673
Pharos: P55285(Tbio)
UniProt: P55285
Structure
PDB: 

Jmol
Position
5p13.3
AA seq 790 aa AA seqDB search
MRTYRYFLLLFWVGQPYPTLSTPLSKRTSGFPAKKRALELSGNSKNELNRSKRSWMWNQF
FLLEEYTGSDYQYVGKLHSDQDRGDGSLKYILSGDGAGDLFIINENTGDIQATKRLDREE
KPVYILRAQAINRRTGRPVEPESEFIIKIHDINDNEPIFTKEVYTATVPEMSDVGTFVVQ
VTATDADDPTYGNSAKVVYSILQGQPYFSVESETGIIKTALLNMDRENREQYQVVIQAKD
MGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPESSPPGTPIGRIKASDADVGEN
AEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLY
LGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNPVKYS
VDRHTDMDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQSSRVPLYIKVLD
VNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQ
DNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSC
HAEALIHPTGLSTGALVAILLCIVILLVTVVLFAALRRQRKKEPLIISKEDIRDNIVSYN
DEGGGEEDTQAFDIGTLRNPEAIEDNKLRRDIVPEALFLPRRTPTARDNTDVRDFINQRL
KENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDADQDYDYLSDWGPRFKKLADM
YGGVDSDKDS
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgagaacttaccgctacttcttgctgctcttttgggtgggccagccctacccaactctc
tcaactccactatcaaagaggactagtggtttcccagcaaagaaaagggccctggagctc
tctggaaacagcaaaaatgagctgaaccgttcaaaaaggagctggatgtggaatcagttc
tttctcctggaggaatacacaggatccgattatcagtatgtgggcaagttacattcagac
caggatagaggagatggatcacttaaatatatcctttcaggagatggagcaggagatctc
ttcattattaatgaaaacacaggcgacatacaggccaccaagaggctggacagggaagaa
aaacccgtttacatccttcgagctcaagctataaacagaaggacagggagacccgtggag
cccgagtctgaattcatcatcaagatccatgacatcaatgacaatgaaccaatattcacc
aaggaggtttacacagccactgtccctgaaatgtctgatgtcggtacatttgttgtccaa
gtcactgcgacggatgcagatgatccaacatatgggaacagtgctaaagttgtctacagt
attctacagggacagccctatttttcagttgaatcagaaacaggtattatcaagacagct
ttgctcaacatggatcgagaaaacagggagcagtaccaagtggtgattcaagccaaggat
atgggcggccagatgggaggattatctgggaccaccaccgtgaacatcacactgactgat
gtcaacgacaaccctccccgattcccccagagtacataccagtttaaaactcctgaatct
tctccaccggggacaccaattggcagaatcaaagccagcgacgctgatgtgggagaaaat
gctgaaattgagtacagcatcacagacggtgaggggctggatatgtttgatgtcatcacc
gaccaggaaacccaggaagggattataactgtcaaaaagctcttggactttgaaaagaag
aaagtgtatacccttaaagtggaagcctccaatccttatgttgagccacgatttctctac
ttggggcctttcaaagattcagccacggttagaattgtggtggaggatgtagatgagcca
cctgtcttcagcaaactggcctacatcttacaaataagagaagatgctcagataaacacc
acaataggctccgtcacagcccaagatccagatgctgccaggaatcctgtcaagtactct
gtagatcgacacacagatatggacagaatattcaacattgattctggaaatggttcgatt
tttacatcgaaacttcttgaccgagaaacactgctatggcacaacattacagtgatagca
acagagatcaataatccaaagcaaagtagtcgagtacctctatatattaaagttctagat
gtcaatgacaacgccccagaatttgctgagttctatgaaacttttgtctgtgaaaaagca
aaggcagatcagttgattcagaccctgcatgctgttgacaaggatgacccttatagtgga
caccaattttcgttttccttggcccctgaagcagccagtggctcaaactttaccattcaa
gacaacaaagacaacacggcgggaatcttaactcggaaaaatggctataatagacacgag
atgagcacctatctcttgcctgtggtcatttcagacaacgactacccagttcaaagcagc
actgggacagtgactgtccgggtctgtgcatgtgaccaccacgggaacatgcaatcctgc
catgcggaggcgctcatccaccccacgggactgagcacgggggctctggttgccatcctt
ctgtgcatcgtgatcctactagtgacagtggtgctgtttgcagctctgaggcggcagcga
aaaaaagagcctttgatcatttccaaagaggacatcagagataacattgtcagttacaac
gacgaaggtggtggagaggaggacacccaggcttttgatatcggcaccctgaggaatcct
gaagccatagaggacaacaaattacgaagggacattgtgcccgaagcccttttcctaccc
cgacggactccaacagctcgcgacaacaccgatgtcagagatttcattaaccaaaggtta
aaggaaaatgacacggaccccactgccccgccatacgactccttggccacttacgcctat
gaaggcactggctccgtggcggattccctgagctcgctggagtcagtgaccacggatgca
gatcaagactatgattaccttagtgactggggacctcgattcaaaaagcttgcagatatg
tatggaggagtggacagtgacaaagactcctaa

DBGET integrated database retrieval system