KEGG   Homo sapiens (human): 10048Help
Entry
10048             CDS       T01001                                 

Gene name
RANBP9, BPM-L, BPM90, RANBPM, RanBP7
Definition
(RefSeq) RAN binding protein 9
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p23
AA seq 729 aa AA seqDB search
MSGQPPPPPPQQQQQQQQLSPPPPAALAPVSGVVLPAPPAVSAGSSPAGSPGGGAGGEGL
GAAAAALLLHPPPPPPPATAAPPPPPPPPPPPASAAAPASGPPAPPGLAAGPGPAGGAPT
PALVAGSSAAAPFPHGDSALNEQEKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGL
SQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVN
MNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHS
LGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKIQAQIDRFPIGD
REGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMG
EAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRP
FSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVP
ELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEV
DSSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRDCGKNTANKKMLKDAFSLLAYSDP
WNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGIGSCA
FATVEDYLH
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggcagccgccgccgccgccgccgcagcagcagcaacagcagcagcagctgtcg
ccgccaccgccggcggccttggccccagtctccggagtcgtcctgccggcgcccccggcc
gtcagcgccggctcttctccggccggctcgcccggcggcggtgcgggcggcgaaggctta
ggggccgcggcggccgccctgctcctccaccctccgccgccgccgcccccggccaccgcg
gccccgccgcccccgccgccgcccccgcctccccctgcctcagcggctgcccccgccagc
gggccgcccgctcccccgggccttgcagcgggccccggcccggctggaggagccccgacc
ccagctctggtggcgggcagcagcgccgcggcccccttccctcacggggactcggccctg
aacgagcaggagaaggagttgcagcggcggctgaagcgtctctacccggccgtggacgaa
caagagacgccgctgcctcggtcctggagcccgaaggacaagttcagctacatcggcctc
tctcagaacaacctgcgggtgcactacaaaggtcatggcaaaaccccaaaagatgccgcg
tcagttcgagccacgcatccaataccagcagcctgtgggatttattattttgaagtaaaa
attgtcagtaagggaagagatggttacatgggaattggtctttctgctcaaggtgtgaac
atgaatagactaccaggttgggataagcattcatatggttaccatggggatgatggacat
tcgttttgttcttctggaactggacaaccttatggaccaactttcactactggtgatgtc
attggctgttgtgttaatcttatcaacaatacctgcttttacaccaagaatggacatagt
ttaggtattgctttcactgacctaccgccaaatttgtatcctactgtggggcttcaaaca
ccaggagaagtggtcgatgccaattttgggcaacatcctttcgtgtttgatatagaagac
tatatgcgggagtggagaaccaaaatccaggcacagatagatcgatttcctatcggagat
cgagaaggagaatggcagaccatgatacaaaaaatggtttcatcttatttagtccaccat
gggtactgtgccacagcagaggcctttgccagatctacagaccagaccgttctagaagaa
ttagcttccattaagaatagacaaagaattcagaaattggtattagcaggaagaatggga
gaagccattgaaacaacacaacagttatacccaagtttacttgaaagaaatcctaatctc
cttttcacattaaaagtgcgtcagtttatagaaatggtgaatggtacagatagtgaagta
cgatgtttgggaggccgaagtccaaagtctcaagacagttatcctgttagtcctcgacct
tttagtagtccaagtatgagccccagccatggaatgaatatccacaatttagcatcaggc
aaaggaagcaccgcacatttttcaggttttgaaagttgtagtaatggtgtaatatcaaat
aaagcacatcaatcatattgccatagtaataaacaccagtcatccaacttgaatgtacca
gaactaaacagtataaatatgtcaagatcacagcaagttaataacttcaccagtaatgat
gtagacatggaaacagatcactactccaatggagttggagaaacttcatccaatggtttc
ctaaatggtagctctaaacatgaccacgaaatggaagattgtgacaccgaaatggaagtt
gattcaagtcagttgagacgccagttgtgtggaggaagtcaggccgccatagaaagaatg
atccactttggacgagagctgcaagcaatgagtgaacagctaaggagagactgtggcaag
aacactgcaaacaaaaaaatgttgaaggatgcattcagtctactagcatattcagatccc
tggaacagcccagttggaaatcagcttgacccgattcagagagaacctgtgtgctcagct
cttaacagtgcaatattagaaacccacaatctgccaaagcaacctccacttgccctagca
atgggacaggccacacaatgtctaggactgatggctcgatcaggaattggatcctgcgca
tttgccacagtggaagactacctacattag

DBGET integrated database retrieval system