KEGG   Homo sapiens (human): 100506658Help
Entry
100506658         CDS       T01001                                 

Gene name
OCLN, BLCPMG
Definition
occludin (EC:2.1.1.67)
Orthology
K06088  
occludin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Pathogenic Escherichia coli infection
Hepatitis C
Disease
H00840  
Band-like calcification with simplified gyration and polymicrogyria (BLC-PMG)
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q13.1
AA seq 522 aa AA seqDB search
MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGY
GYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSA
ILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVD
PQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN
VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPV
DDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREY
PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADE
YNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaggcctcttgaaagtccacctccttacaggcctgatgaattcaaaccgaat
cattatgcaccaagcaatgacatatatggtggagagatgcatgttcgaccaatgctctct
cagccagcctactctttttacccagaagatgaaattcttcacttctacaaatggacctct
cctccaggagtgattcggatcctgtctatgctcattattgtgatgtgcattgccatcttt
gcctgtgtggcctccacgcttgcctgggacagaggctatggaacttcccttttaggaggt
agtgtaggctacccttatggaggaagtggctttggtagctacggaagtggctatggctat
ggctatggttatggctatggctacggaggctatacagacccaagagcagcaaagggcttc
atgttggccatggctgccttttgtttcattgccgcgttggtgatctttgttaccagtgtt
ataagatctgaaatgtccagaacaagaagatactacttaagtgtgataatagtgagtgct
atcctgggcatcatggtgtttattgccacaattgtctatataatgggagtgaacccaact
gctcagtcttctggatctctatatggttcacaaatatatgccctctgcaaccaattttat
acacctgcagctactggactctacgtggatcagtatttgtatcactactgtgttgtggat
ccccaggaggccattgccattgtactggggttcatgattattgtggcttttgctttaata
attttctttgctgtgaaaactcgaagaaagatggacaggtatgacaagtccaatattttg
tgggacaaggaacacatttatgatgagcagccccccaatgtcgaggagtgggttaaaaat
gtgtctgcaggcacacaggacgtgccttcacccccatctgactatgtggaaagagttgac
agtcccatggcatactcttccaatggcaaagtgaatgacaagcggttttatccagagtct
tcctataaatccacgccggttcctgaagtggttcaggagcttccattaacttcgcctgtg
gatgacttcaggcagcctcgttacagcagcggtggtaactttgagacaccttcaaaaaga
gcacctgcaaagggaagagcaggaaggtcaaagagaacagagcaagatcactatgagaca
gactacacaactggcggcgagtcctgtgatgagctggaggaggactggatcagggaatat
ccacctatcacttcagatcaacaaagacaactgtacaagaggaattttgacactggccta
caggaatacaagagcttacaatcagaacttgatgagatcaataaagaactctcccgtttg
gataaagaattggatgactatagagaagaaagtgaagagtacatggctgctgctgatgaa
tacaatagactgaagcaagtgaagggatctgcagattacaaaagtaagaagaatcattgc
aagcagttaaagagcaaattgtcacacatcaagaagatggttggagactatgatagacag
aaaacatag

DBGET integrated database retrieval system