KEGG   Homo sapiens (human): 100506658Help
Entry
100506658         CDS       T01001                                 

Gene name
OCLN, BLCPMG, PPP1R115, PTORCH1
Definition
(RefSeq) occludin
  KO
K06088  occludin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Disease
H00840  Band-like calcification with simplified gyration and polymicrogyria (BLC-PMG)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100506658 (OCLN)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    100506658 (OCLN)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100506658 (OCLN)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    100506658 (OCLN)
   05160 Hepatitis C
    100506658 (OCLN)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100506658 (OCLN)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   100506658 (OCLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL Occludin_ELL Laminin_II TBPIP APG6 DUF4164 TMF_TATA_bd FapA KxDL DUF4200 GAS UPF0184 DUF5305 CENP-H
Motif
Other DBs
NCBI-GeneID: 100506658
NCBI-ProteinID: NP_001192183
OMIM: 602876
HGNC: 8104
Ensembl: ENSG00000197822
Vega: OTTHUMG00000099356
Pharos: Q16625(Tbio)
UniProt: Q16625 A8K3T2
Structure
PDB: 

Jmol
Position
5q13.2
AA seq 522 aa AA seqDB search
MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGY
GYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSA
ILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVD
PQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN
VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPV
DDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREY
PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADE
YNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaggcctcttgaaagtccacctccttacaggcctgatgaattcaaaccgaat
cattatgcaccaagcaatgacatatatggtggagagatgcatgttcgaccaatgctctct
cagccagcctactctttttacccagaagatgaaattcttcacttctacaaatggacctct
cctccaggagtgattcggatcctgtctatgctcattattgtgatgtgcattgccatcttt
gcctgtgtggcctccacgcttgcctgggacagaggctatggaacttcccttttaggaggt
agtgtaggctacccttatggaggaagtggctttggtagctacggaagtggctatggctat
ggctatggttatggctatggctacggaggctatacagacccaagagcagcaaagggcttc
atgttggccatggctgccttttgtttcattgccgcgttggtgatctttgttaccagtgtt
ataagatctgaaatgtccagaacaagaagatactacttaagtgtgataatagtgagtgct
atcctgggcatcatggtgtttattgccacaattgtctatataatgggagtgaacccaact
gctcagtcttctggatctctatatggttcacaaatatatgccctctgcaaccaattttat
acacctgcagctactggactctacgtggatcagtatttgtatcactactgtgttgtggat
ccccaggaggccattgccattgtactggggttcatgattattgtggcttttgctttaata
attttctttgctgtgaaaactcgaagaaagatggacaggtatgacaagtccaatattttg
tgggacaaggaacacatttatgatgagcagccccccaatgtcgaggagtgggttaaaaat
gtgtctgcaggcacacaggacgtgccttcacccccatctgactatgtggaaagagttgac
agtcccatggcatactcttccaatggcaaagtgaatgacaagcggttttatccagagtct
tcctataaatccacgccggttcctgaagtggttcaggagcttccattaacttcgcctgtg
gatgacttcaggcagcctcgttacagcagcggtggtaactttgagacaccttcaaaaaga
gcacctgcaaagggaagagcaggaaggtcaaagagaacagagcaagatcactatgagaca
gactacacaactggcggcgagtcctgtgatgagctggaggaggactggatcagggaatat
ccacctatcacttcagatcaacaaagacaactgtacaagaggaattttgacactggccta
caggaatacaagagcttacaatcagaacttgatgagatcaataaagaactctcccgtttg
gataaagaattggatgactatagagaagaaagtgaagagtacatggctgctgctgatgaa
tacaatagactgaagcaagtgaagggatctgcagattacaaaagtaagaagaatcattgc
aagcagttaaagagcaaattgtcacacatcaagaagatggttggagactatgatagacag
aaaacatag

DBGET integrated database retrieval system