KEGG   Homo sapiens (human): 100506658Help
Entry
100506658         CDS       T01001                                 

Gene name
OCLN, BLCPMG
Definition
occludin (EC:2.1.1.67)
Orthology
K06088  
occludin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Pathogenic Escherichia coli infection
Hepatitis C
Disease
H00840  
Band-like calcification with simplified gyration and polymicrogyria (BLC-PMG)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100506658 (OCLN)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    100506658 (OCLN)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100506658 (OCLN)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    100506658 (OCLN)
   05160 Hepatitis C
    100506658 (OCLN)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100506658 (OCLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q13.1
AA seq 522 aa AA seqDB search
MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGY
GYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSA
ILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVD
PQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN
VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPV
DDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREY
PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADE
YNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaggcctcttgaaagtccacctccttacaggcctgatgaattcaaaccgaat
cattatgcaccaagcaatgacatatatggtggagagatgcatgttcgaccaatgctctct
cagccagcctactctttttacccagaagatgaaattcttcacttctacaaatggacctct
cctccaggagtgattcggatcctgtctatgctcattattgtgatgtgcattgccatcttt
gcctgtgtggcctccacgcttgcctgggacagaggctatggaacttcccttttaggaggt
agtgtaggctacccttatggaggaagtggctttggtagctacggaagtggctatggctat
ggctatggttatggctatggctacggaggctatacagacccaagagcagcaaagggcttc
atgttggccatggctgccttttgtttcattgccgcgttggtgatctttgttaccagtgtt
ataagatctgaaatgtccagaacaagaagatactacttaagtgtgataatagtgagtgct
atcctgggcatcatggtgtttattgccacaattgtctatataatgggagtgaacccaact
gctcagtcttctggatctctatatggttcacaaatatatgccctctgcaaccaattttat
acacctgcagctactggactctacgtggatcagtatttgtatcactactgtgttgtggat
ccccaggaggccattgccattgtactggggttcatgattattgtggcttttgctttaata
attttctttgctgtgaaaactcgaagaaagatggacaggtatgacaagtccaatattttg
tgggacaaggaacacatttatgatgagcagccccccaatgtcgaggagtgggttaaaaat
gtgtctgcaggcacacaggacgtgccttcacccccatctgactatgtggaaagagttgac
agtcccatggcatactcttccaatggcaaagtgaatgacaagcggttttatccagagtct
tcctataaatccacgccggttcctgaagtggttcaggagcttccattaacttcgcctgtg
gatgacttcaggcagcctcgttacagcagcggtggtaactttgagacaccttcaaaaaga
gcacctgcaaagggaagagcaggaaggtcaaagagaacagagcaagatcactatgagaca
gactacacaactggcggcgagtcctgtgatgagctggaggaggactggatcagggaatat
ccacctatcacttcagatcaacaaagacaactgtacaagaggaattttgacactggccta
caggaatacaagagcttacaatcagaacttgatgagatcaataaagaactctcccgtttg
gataaagaattggatgactatagagaagaaagtgaagagtacatggctgctgctgatgaa
tacaatagactgaagcaagtgaagggatctgcagattacaaaagtaagaagaatcattgc
aagcagttaaagagcaaattgtcacacatcaagaagatggttggagactatgatagacag
aaaacatag

DBGET integrated database retrieval system