KEGG   Homo sapiens (human): 100506742Help
Entry
100506742         CDS       T01001                                 

Gene name
CASP12, CASP-12, CASP12P1
Definition
caspase 12 (gene/pseudogene)
Orthology
K04741  
caspase 12 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Prion diseases
Hepatitis B
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100506742 (CASP12)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100506742 (CASP12)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100506742 (CASP12)
   05014 Amyotrophic lateral sclerosis (ALS)
    100506742 (CASP12)
   05020 Prion diseases
    100506742 (CASP12)
  Infectious diseases
   05161 Hepatitis B
    100506742 (CASP12)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     100506742 (CASP12)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   100506742 (CASP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
11q22.3
AA seq 341 aa AA seqDB search
MADEKPSNGVLVHMVKLLIKTFLDGIFDDLMENNVLNTDEIHLIGKCLKFVVSNAENLVD
DITETAQIAGKIFREHLWNSKKQLSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELD
LLGMRDLLENLGYSVVIKENLTAQEMETALRQFAAHPEHQSSDSTFLVFMSHSILNGICG
TKHWDQEPDVLHDDTIFEIFNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASAD
THGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS
HHLEEIFQKVQHSFETPNILTQLPTIERLSMTRYFYLFPGN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgagaaaccatccaacggtgttctggtccacatggtgaagttgctgatcaag
acctttctagatggcatttttgatgatttgatggaaaataatgtgttaaatacagatgag
atacaccttataggaaaatgtctaaagtttgtggtgagcaatgctgaaaacctggttgat
gatatcactgagacagctcaaattgcaggcaaaatatttagggaacacctgtggaattcc
aaaaaacagctgagttcagatatatccagtgatggagaaagagaggcgaacatgcctggc
ctcaacatccgcaacaaagaattcaactatcttcataatcgaaatggttctgaacttgac
cttttggggatgcgagatctacttgaaaaccttggatactcagtggttataaaagagaat
ctcacagctcaggaaatggaaacagcactaaggcagtttgctgctcacccagagcaccag
tcctcagacagcacattcctggtgtttatgtcacatagcatcctgaatggaatctgtggg
accaagcactgggatcaagagccagatgttcttcacgatgacaccatctttgaaattttc
aacaaccgtaactgccagagtctgaaagacaaacccaaggtcatcatcatgcaagcctgc
cgaggcaatggtgctgggattgtttggttcaccactgacagtggaaaagccagtgcagat
actcatggtcggctcttgcaaggtaacatctgtaatgatgctgttacaaaggctcatgtg
gaaaaggacttcattgctttcaaatcttccacaccacataatgtttcttggagacatgaa
acaaatggctctgtcttcatttcccaaattatctactacttcagagagtattcttggagt
catcatctagaggaaatttttcaaaaggttcaacattcatttgagaccccaaatatactg
acccagctgcccaccattgaaagactatccatgacacgatatttctatctctttcctggg
aattaa

DBGET integrated database retrieval system