KEGG   Homo sapiens (human): 100507436Help
Entry
100507436         CDS       T01001                                 

Gene name
MICA, MIC-A, PERB11.1
Definition
MHC class I polypeptide-related sequence A
Orthology
K07985  
MHC class I-related protein
Organism
hsa  Homo sapiens (human)
Pathway
Natural killer cell mediated cytotoxicity
Disease
H00288  
Familial Mediterranean fever (FMF)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100507436 (MICA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 383 aa AA seqDB search
MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCD
RQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCE
IHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHY
HAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWR
QDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKV
LVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHR
DATQLGFQPLMSDLGSTGSTEGA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggggctgggcccggtcttcctgcttctggctggcatcttcccttttgcacctccggga
gctgctgctgagccccacagtcttcgttataacctcacggtgctgtcctgggatggatct
gtgcagtcagggtttctcactgaggtacatctggatggtcagcccttcctgcgctgtgac
aggcagaaatgcagggcaaagccccagggacagtgggcagaagatgtcctgggaaataag
acatgggacagagagaccagagacttgacagggaacggaaaggacctcaggatgaccctg
gctcatatcaaggaccagaaagaaggcttgcattccctccaggagattagggtctgtgag
atccatgaagacaacagcaccaggagctcccagcatttctactacgatggggagctcttc
ctctcccaaaacctggagactaaggaatggacaatgccccagtcctccagagctcagacc
ttggccatgaacgtcaggaatttcttgaaggaagatgccatgaagaccaagacacactat
cacgctatgcatgcagactgcctgcaggaactacggcgatatctaaaatccggcgtagtc
ctgaggagaacagtgccccccatggtgaatgtcacccgcagcgaggcctcagagggcaac
attaccgtgacatgcagggcttctggcttctatccctggaatatcacactgagctggcgt
caggatggggtatctttgagccacgacacccagcagtggggggatgtcctgcctgatggg
aatggaacctaccagacctgggtggccaccaggatttgccaaggagaggagcagaggttc
acctgctacatggaacacagcgggaatcacagcactcaccctgtgccctctgggaaagtg
ctggtgcttcagagtcattggcagacattccatgtttctgctgttgctgctgctgctatt
tttgttattattattttctatgtccgttgttgtaagaagaaaacatcagctgcagagggt
ccagagctcgtgagcctgcaggtcctggatcaacacccagttgggacgagtgaccacagg
gatgccacacagctcggatttcagcctctgatgtcagatcttgggtccactggctccact
gagggcgcctag

DBGET integrated database retrieval system