KEGG   Homo sapiens (human): 100507436Help
Entry
100507436         CDS       T01001                                 

Gene name
MICA, MIC-A, PERB11.1
Definition
(RefSeq) MHC class I polypeptide-related sequence A
  KO
K07985  MHC class I-related protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
Network
N00185  KSHV MIR2 to cell surface molecule-endocytosis
N00210  KSHV MIR1/2 to host-cell-protein inhibition
Disease
H00288  Familial Mediterranean fever (FMF)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100507436 (MICA)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100507436 (MICA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set Ig_3 TDH Ig_2
Motif
Other DBs
NCBI-GeneID: 100507436
NCBI-ProteinID: NP_000238
OMIM: 600169
HGNC: 7090
Ensembl: ENSG00000204520
Vega: OTTHUMG00000031073
Pharos: Q29983(Tbio)
UniProt: Q29983
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 383 aa AA seqDB search
MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCD
RQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCE
IHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHY
HAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWR
QDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKV
LVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHR
DATQLGFQPLMSDLGSTGSTEGA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggggctgggcccggtcttcctgcttctggctggcatcttcccttttgcacctccggga
gctgctgctgagccccacagtcttcgttataacctcacggtgctgtcctgggatggatct
gtgcagtcagggtttctcactgaggtacatctggatggtcagcccttcctgcgctgtgac
aggcagaaatgcagggcaaagccccagggacagtgggcagaagatgtcctgggaaataag
acatgggacagagagaccagagacttgacagggaacggaaaggacctcaggatgaccctg
gctcatatcaaggaccagaaagaaggcttgcattccctccaggagattagggtctgtgag
atccatgaagacaacagcaccaggagctcccagcatttctactacgatggggagctcttc
ctctcccaaaacctggagactaaggaatggacaatgccccagtcctccagagctcagacc
ttggccatgaacgtcaggaatttcttgaaggaagatgccatgaagaccaagacacactat
cacgctatgcatgcagactgcctgcaggaactacggcgatatctaaaatccggcgtagtc
ctgaggagaacagtgccccccatggtgaatgtcacccgcagcgaggcctcagagggcaac
attaccgtgacatgcagggcttctggcttctatccctggaatatcacactgagctggcgt
caggatggggtatctttgagccacgacacccagcagtggggggatgtcctgcctgatggg
aatggaacctaccagacctgggtggccaccaggatttgccaaggagaggagcagaggttc
acctgctacatggaacacagcgggaatcacagcactcaccctgtgccctctgggaaagtg
ctggtgcttcagagtcattggcagacattccatgtttctgctgttgctgctgctgctatt
tttgttattattattttctatgtccgttgttgtaagaagaaaacatcagctgcagagggt
ccagagctcgtgagcctgcaggtcctggatcaacacccagttgggacgagtgaccacagg
gatgccacacagctcggatttcagcctctgatgtcagatcttgggtccactggctccact
gagggcgcctag

DBGET integrated database retrieval system