KEGG   Homo sapiens (human): 100526835Help
Entry
100526835         CDS       T01001                                 

Gene name
FPGT-TNNI3K
Definition
FPGT-TNNI3K readthrough
Orthology
K17535  
serine/threonine-protein kinase TNNI3K [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.1
AA seq 949 aa AA seqDB search
MRAVRRGLREGGAMAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADE
KQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSF
TILLIHSDEWKKKVSESYVITIERLEDDLQIKEKELTELRNIFGSDEAFSKVNLNYRTEN
GLSLLHLCCICGGKKSHIRTLMLKGLRPSRLTRNGFTALHLAVYKDNAELITSLLHSGAD
IQQVGYGGLTALHIATIAGHLEAADVLLQHGANVNIQDAVFFTPLHIAAYYGHEQVTRLL
LKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNEDHVPLHFCSRFG
HHDIVKYLLQSDLEVQPHVVNIYGDTPLHLACYNGKFEVAKEIIQISGTESLTKENIFSE
TAFHSACTYGKSIDLVKFLLDQNVININHQGRDGHTGLHSACYHGHIRLVQFLLDNGADM
NLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEYSQPGGDGSYV
SVPSPLGKIKSMTKEKADILLLRAGLPSHFHLQLSEIEFHEIIGSGSFGKVYKGRCRNKI
VAIKRYRANTYCSKSDVDMFCREVSILCQLNHPCVIQFVGACLNDPSQFAIVTQYISGGS
LFSLLHEQKRILDLQSKLIIAVDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDGHAVVAD
FGESRFLQSLDEDNMTKQPGNLRWMAPEVFTQCTRYTIKADVFSYALCLWEILTGEIPFA
HLKPAAAAADMAYHHIRPPIGYSIPKPISSLLIRGWNACPEGRPEFSEVVMKLEECLCNI
ELMSPASSNSSGSLSPSSSSDCLVNRGGPGRSHVAALRSRFELEYALNARSYAALSQSAG
QYSSQGLSLEEMKRSLQYTPIDKYGYVSDPMSSMHFHSCRNSSSFEDSS
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgtgcggcgcggtctcagggaaggtggggctatggcagctgctagggaccct
ccggaagtatcgctgcgagaagccacccagcgaaaattgcggaggttttccgagctaaga
ggcaaacttgtagcacgtggagaattctgggacatagttgcaataacagcggctgatgaa
aaacaggaacttgcttacaaccaacagctgtcagaaaagctgaaaagaaaggagttaccc
cttggagttcaatatcacgtttttgtggatcctgctggagccaaaattggaaatggagga
tcaacactttgtgcccttcaatgtttggaaaagctatatggagataaatggaattctttt
accatcttattaattcactctgatgaatggaagaaaaaagtcagtgaatcatatgttatc
acaatagaaagattagaagatgacctgcagatcaaggaaaaagaactgacagaactaagg
aatatatttggctctgatgaagccttcagtaaagtcaatttaaattaccgcactgaaaat
gggctgtctctacttcatttatgttgcatttgtggaggcaagaaatcacatattcgaact
cttatgttgaaagggctccgcccatctcgactgacaagaaatggatttacagccttgcat
ttagcagtttacaaggataatgcagaattgatcacttctctgcttcacagtggagctgat
atacagcaggttggatacggtggcctcactgccctccatattgctacaatagctggccac
ctagaggctgctgatgtgctgttgcaacatggagctaatgtcaatattcaagatgcagtt
tttttcactccattgcatattgcagcgtactatggacatgaacaggtaactcgccttctt
ttgaaatttggtgctgatgtaaatgtaagtggtgaagttggagatagacccctccaccta
gcatctgcaaaaggattcttgaatattgcaaaactcttgatggaagaaggcagcaaagca
gatgtgaatgctcaagataatgaagaccatgtcccactccatttctgttctcgatttgga
caccatgatatagttaagtatctgctgcaaagtgatttggaagttcaacctcatgttgtt
aatatctatggagatacccccttacacctggcatgctacaatggcaaatttgaagttgcc
aaggaaatcatccaaatatcaggaacagaaagtctgactaaggaaaacatcttcagtgaa
acagcttttcatagtgcttgtacctatggcaagagcattgacctagtcaaatttcttctt
gatcagaatgtcataaacatcaaccaccaaggaagggatgggcacactggattacactct
gcttgctaccacggtcacattcgcctggttcagttcttactggataatggagctgatatg
aatctagtggcttgtgatcccagcaggtctagtggtgaaaaagatgagcagacatgtttg
atgtgggcttatgaaaaagggcatgatgccattgtcacactcctgaagcattataagaga
ccacaagatgaattgccctgtaatgaatattctcagcctggaggagatggctcctatgtg
tctgttccatcacccttggggaagattaaaagcatgacaaaagagaaggcagatattctc
ctcctaagagctggattgccttcacatttccatcttcagctctcagaaattgagttccat
gagattattggctcaggttcttttgggaaagtatataaaggacgatgcagaaataaaata
gtggctataaaacgttatcgagccaatacctactgctccaagtcagatgtggatatgttt
tgccgagaggtgtccattctctgccagctcaatcatccctgcgtaattcagtttgtgggt
gcttgcttgaatgatcccagccagtttgccattgtcactcaatacatatcagggggttct
ctgttctccctccttcatgagcagaagaggattcttgatttgcagtctaaattaattatt
gcagtagatgttgccaaaggcatggagtaccttcacaacctgacacagccaattatacat
cgtgacttgaacagtcacaatattcttctctatgaggatgggcatgctgtggtggcagat
tttggagaatcaagatttctacagtctctggatgaagacaacatgacaaaacaacctggg
aacctccgttggatggctcctgaggtgttcacgcagtgcactcggtacaccatcaaagca
gatgtcttcagctatgctctgtgtctgtgggaaattctcactggcgaaattccattcgct
catctcaagccagcggctgcggcagcagacatggcttaccaccacatcagacctcccatt
ggctattccattcccaagcccatatcatctctgctgatacgagggtggaacgcatgtcct
gaaggaagacccgaattttctgaagttgtcatgaagttagaagagtgtctctgcaacatt
gagctgatgtctcctgcatcaagtaacagcagtgggtctctctcaccttcttcttcttct
gattgcctggtgaaccggggaggacctggccggagtcatgtggcagcattaagaagtcgt
ttcgaattggaatatgctctaaatgcaaggtcctatgctgctttgtcccaaagtgctgga
caatattcctctcaaggtctgtctttggaggagatgaaaagaagtcttcaatacacaccc
attgacaaatatggctatgtatccgatcccatgagctcaatgcattttcattcttgccga
aatagtagcagctttgaggacagcagctga

DBGET integrated database retrieval system