KEGG   Homo sapiens (human): 100528030Help
Entry
100528030         CDS       T01001                                 

Gene name
POC1B-GALNT4
Definition
(RefSeq) POC1B-GALNT4 readthrough
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100528030 (POC1B-GALNT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100528030 (POC1B-GALNT4)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  Mucin-type
   100528030 (POC1B-GALNT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100528030
NCBI-ProteinID: NP_001186711
HGNC: 42957
Ensembl: ENSG00000259075
Vega: OTTHUMG00000171333
UniProt: Q8N4A0
Position
12q21.33
AA seq 406 aa AA seqDB search
MAWCVATADPAHTSRPLFTGLAVSRGSAGHAWSAGFDWAAVVVVTGRRCRSGQTVPGAAR
SPLLPHPLPSPLRVPPPTGALGRPLPRWPQPRRTPFWSVISKATKLRSPPWTSAPTASNL
ERDRRISRIDPIRSPTMAGGLFAVSKKYFQYLGTYDTGMEVWGGENLELSFRVWQCGGKL
EIHPCSHVGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDISER
KLLRERLRCKSFDWYLKNVFPNLHVPEDRPGWHGAIRSRGISSECLDYNSPDNNPTGANL
SLFGCHGQGGNQFFEYTSNKEIRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWH
FKEDGTIFHPHSGLCLSAYRTPEGRPDVQMRTCDALDKNQIWSFEK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcttggtgtgtggccacagctgacccggcgcatacctcccgtcctctctttacaggg
ctggcggtgtctcggggctcggctggccatgcctggagcgcggggtttgactgggccgcc
gttgttgtagtgaccgggaggcgctgccgctctgggcagacggttccgggagccgcacgg
tcccctctccttccccatcctctcccctcccctctccgggttcccccacccacaggagcc
ttgggccgaccactcccccgatggcctcagccacggaggaccccgttctggagcgttatt
tcaaaggccacaaagctgcgatcacctccttggacctcagccccaacggcaagcaacttg
gaaagggacaggcggatatcaagaattgaccccatcagatcacctaccatggctggagga
ctgtttgctgtcagcaagaaatattttcagtaccttggaacgtatgacacaggaatggaa
gtgtggggaggtgaaaaccttgagctgtcttttagggtgtggcagtgtggtggcaaattg
gagatccacccgtgttcccacgtgggccatgtgttccccaagcgggcaccatatgctcgc
cccaatttcctacagaatactgctcgggcagcagaagtttggatggatgaatacaaagag
cacttctacaatagaaaccctccagcaagaaaagaagcttatggtgatatttctgaaaga
aaattactacgagagcggttgagatgcaagagctttgactggtatttgaaaaacgttttt
cctaatttacatgttccagaggatagaccaggctggcatggggctattcgcagtagaggg
atctcgtctgaatgtttagattataattctcctgacaacaaccccacaggtgctaacctt
tcactgtttggatgccatggtcaaggaggcaatcaattctttgaatatacttcaaacaaa
gaaataaggtttaattctgtgacagagttatgtgcagaggtacctgagcaaaaaaattat
gtgggaatgcaaaattgtcccaaagatgggttccctgtaccagcaaacattatttggcat
tttaaagaagatggaactatttttcacccacactcaggactgtgtcttagtgcttatcgg
acaccggagggccgacctgatgtacaaatgagaacttgtgatgctctagataaaaatcaa
atttggagttttgagaaatag

DBGET integrated database retrieval system