KEGG   Homo sapiens (human): 10054Help
Entry
10054             CDS       T01001                                 

Gene name
UBA2, ARX, HRIHFB2115, SAE2
Definition
(RefSeq) ubiquitin like modifier activating enzyme 2
  KO
K10685  
ubiquitin-like 1-activating enzyme E1 B [EC:6.2.1.45]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10054 (UBA2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     10054 (UBA2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   10054 (UBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q12
AA seq 640 aa AA seqDB search
MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQ
FLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRA
ARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPS
EPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQ
NEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAAN
LRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNK
QPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDV
QIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGK
DVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNN
ADVSEEERSRKRKLDEKENLSAKRSRIEQKEELDDVIALD
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggcactgtcgcgggggctgccccgggagctggctgaggcggtggccgggggccgggtg
ctggtggtgggggcgggcggcatcggctgcgagctcctcaagaatctcgtgctcaccggt
ttctcccacatcgacctgattgatctggatactattgatgtaagcaacctcaacagacag
tttttgtttcaaaagaaacatgttggaagatcaaaggcacaggttgccaaggaaagtgta
ctgcagttttacccgaaagctaatatcgttgcctaccatgacagcatcatgaaccctgac
tataatgtggaatttttccgacagtttatactggttatgaatgctttagataacagagct
gcccgaaaccatgttaatagaatgtgcctggcagctgatgttcctcttattgaaagtgga
acagctgggtatcttggacaagtaactactatcaaaaagggtgtgaccgagtgttatgag
tgtcatcctaagccgacccagagaacctttcctggctgtacaattcgtaacacaccttca
gaacctatacattgcatcgtttgggcaaagtacttgttcaaccagttgtttggggaagaa
gatgctgatcaagaagtatctcctgacagagctgaccctgaagctgcctgggaaccaacg
gaagccgaagccagagctagagcatctaatgaagatggtgacattaaacgtatttctact
aaggaatgggctaaatcaactggatatgatccagttaaactttttaccaagctttttaaa
gatgacatcaggtatctgttgacaatggacaaactatggcggaaaaggaaacctccagtt
ccgttggactgggctgaagtacaaagtcaaggagaagaaacgaatgcatcagatcaacag
aatgaaccccagttaggcctgaaagaccagcaggttctagatgtaaagagctatgcacgt
cttttttcaaagagcatcgagactttgagagttcatttagcagaaaagggggatggagct
gagctcatatgggataaggatgacccatctgcaatggattttgtcacctctgctgcaaac
ctcaggatgcatattttcagtatgaatatgaagagtagatttgatatcaaatcaatggca
gggaacattattcctgctattgctactactaatgcagtaattgctgggttgatagtattg
gaaggattgaagattttatcaggaaaaatagaccagtgcagaacaatttttttgaataaa
caaccaaacccaagaaagaagcttcttgtgccttgtgcactggatcctcccaaccccaat
tgttatgtatgtgccagcaagccagaggtgactgtgcggctgaatgtccataaagtgact
gttctcaccttacaagacaagatagtgaaagaaaaatttgctatggtagcaccagatgtc
caaattgaagatgggaaaggaacaatcctaatatcttccgaagagggagagacggaagct
aataatcacaagaagttgtcagaatttggaattagaaatggcagccggcttcaagcagat
gacttcctccaggactatactttattgatcaacatccttcatagtgaagacctaggaaag
gacgttgaatttgaagttgttggtgatgccccggaaaaagtggggcccaaacaagctgaa
gatgctgccaaaagcataaccaatggcagtgatgatggagctcagccctccacctccaca
gctcaagagcaagatgacgttctcatagttgattcagatgaagaagattcttcaaataat
gccgacgtcagtgaagaagagagaagccgcaagaggaaattagatgagaaagagaatctc
agtgcaaagaggtcacgtatagaacagaaggaagagcttgatgatgtcatagcattagat
tga

DBGET integrated database retrieval system