KEGG   Homo sapiens (human): 10056Help
Entry
10056             CDS       T01001                                 

Gene name
FARSB, FARSLB, FRSB, PheHB, PheRS
Definition
phenylalanyl-tRNA synthetase, beta subunit (EC:6.1.1.20)
Orthology
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    10056 (FARSB)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     10056 (FARSB)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   10056 (FARSB)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    10056 (FARSB)
 Prokaryotic Type
    10056 (FARSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q36.1
AA seq 589 aa AA seqDB search
MPTVSVKRDLLFQALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDV
VLYKIDVPANRYDLLCLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPF
AVAAVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSD
IKFKPLNKTKEYTACELMNIYKTDNHLKHYLHIIENKPLYPVIYDSNGVVLSMPPIINGD
HSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFP
ELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIH
ACDIVEDAAIAYGYNNIQMTLPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQ
EDIADKLGVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEISDI
VIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVIKASEG
PAFFPGRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINVGPFL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgccgactgtcagcgtgaagcgtgatctgctcttccaagccctgggccgcacctacact
gacgaagaatttgatgaactatgttttgaatttggtctggagcttgatgaaattacatct
gagaaggaaataataagtaaagaacaaggtaatgtaaaggcagcaggagcctctgatgtt
gttctttacaaaattgacgtccctgccaatagatatgatctcctgtgtctggaaggattg
gttcgaggacttcaggtcttcaaagaaaggataaaggctccagtgtataaacgggtaatg
cctgatggaaaaatccagaaattgattatcacagaagagacagctaagatacgtcctttt
gcggtagcagcagttctccgtaatataaagtttactaaagatcgatatgacagcttcatt
gaacttcaggagaaattacatcagaatatttgcaggaaaagagcactggttgccattggt
acccatgatttggacactttgtcgggcccatttacttatactgcaaagcgtccttcagat
atcaaattcaagcctctaaataagaccaaggagtatacagcctgtgaactgatgaacata
tacaagactgacaatcacctgaaacattatttacatatcattgaaaacaaacccctgtat
ccagttatctatgatagcaatggtgtcgtcctttcaatgcctcccatcatcaatggggat
cattccagaataacagtaaatactagaaatatttttattgaatgcacgggaactgacttt
actaaggcaaaaatagttcttgatattattgtcaccatgttcagtgaatattgtgagaat
caatttacggtcgaagctgctgaagtggtttttcctaatggaaaatcacatacctttcca
gaattagcttaccgaaaggagatggtgagagctgacctaattaacaaaaaagttggaatc
agagaaactccagaaaatcttgccaaacttctgaccaggatgtatttaaaatcagaagtc
ataggtgatgggaatcagattgagattgaaatccctccaaccagagctgacattatccat
gcatgtgatattgtagaagatgcagctattgcttatggatataacaacattcagatgact
ctcccgaaaacttacaccatagctaatcaatttcctcttaataagctcactgaacttctc
cgacatgacatggcagccgctggcttcactgaagcacttacctttgccctgtgctcccaa
gaagatattgctgataaactaggtgtggatatctctgcaacaaaggcagtccacataagt
aatcctaaaacagctgaatttcaggtggcacgcactacccttcttcctggcctcctgaag
accatagcagcaaatcgtaagatgccccttccactgaaactgtttgaaatctctgacatt
gtaataaaagattctaatacagatgtaggtgcaaaaaactacagacatctctgtgctgtt
tattacaacaagaatcctgggtttgagatcattcatgggctgctggacagaattatgcag
ttgctcgatgtgcctcctggtgaagacaaggggggatatgtgatcaaagcatcagaaggg
cctgctttcttccccgggcgatgtgcagagatctttgccaggggtcaaagcgtcgggaag
cttggggtccttcatcctgacgttatcaccaaatttgagctgaccatgccctgctcctcc
ctagaaatcaatgttggaccctttttgtga

DBGET integrated database retrieval system