KEGG   Homo sapiens (human): 10059Help
Entry
10059             CDS       T01001                                 

Gene name
DNM1L, DLP1, DRP1, DVLP, DYMPLE, EMPF, HDYNIV
Definition
dynamin 1-like (EC:3.6.5.5)
Orthology
K17065  
dynamin 1-like protein [EC:3.6.5.5]
Organism
hsa  Homo sapiens (human)
Pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    10059 (DNM1L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     10059 (DNM1L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    10059 (DNM1L)
   Retention of mitochondria
    10059 (DNM1L)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10059 (DNM1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p11.21
AA seq 725 aa AA seqDB search
MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTR
RPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISG
NNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSI
ILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG
IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDC
LPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSEL
CGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTN
EMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSAL
APASQEPSPAASAEADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIP
IMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVM
HFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIR
ETHLW
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctaattcctgtcataaacaagctccaggacgtcttcaacacggtgggcgcc
gacatcatccagctgcctcaaatcgtcgtagtgggaacgcagagcagcggaaagagctca
gtgctagaaagcctggtggggagggacctgcttcccagaggtactggaattgtcacccgg
agacctctcattctgcaactggtccatgtttcacaagaagataaacggaaaacaacagga
gaagaaaatggggtggaagcagaagaatggggtaaatttcttcacaccaaaaataagctt
tacacggattttgatgaaattcgacaagaaattgaaaatgaaacagaaagaatttcagga
aataataagggagtaagccctgaaccaattcatcttaagattttttcacccaacgttgtc
aatttgacacttgtggatttgccaggaatgaccaaggtgcctgtaggtgatcaacctaag
gatattgagcttcaaatcagagagctcattcttcggttcatcagtaatcctaattccatt
atcctcgctgtcactgctgctaatacagatatggcaacatcagaggcacttaaaatttca
agagaggtagatccagatggtcgcagaaccctagctgtaatcactaaacttgatctcatg
gatgcgggtactgatgccatggatgtattgatgggaagggttattccagtcaaacttgga
ataattggagtagttaacaggagccagctagatattaacaacaagaagagtgtaactgat
tcaatccgtgatgagtatgcttttcttcaaaagaaatatccatctctggccaatagaaat
ggaacaaagtatcttgctaggactctaaacaggttactgatgcatcacatcagagattgt
ttaccagagttgaaaacaagaataaatgttctagctgctcagtatcagtctcttctaaat
agctacggtgaacccgtggatgataaaagtgctactttactccaacttattaccaaattt
gccacagaatattgtaacactattgaaggaactgcaaaatatattgaaacttcggagcta
tgcggtggtgctagaatttgttatattttccatgagacttttgggcgaaccttagaatct
gttgatccacttggtggccttaacactattgacattttgactgccattagaaatgctact
ggtcctcgtcctgctttatttgtgcctgaggtttcatttgagttactggtgaagcggcaa
atcaaacgtctagaagagcccagcctccgctgtgtggaactggttcatgaggaaatgcaa
aggatcattcagcactgtagcaattacagtacacaggaattgttacgatttcctaaactt
catgatgccatagttgaagtggtgacttgtcttcttcgtaaaaggttgcctgttacaaat
gaaatggtccataacttagtggcaattgaactggcttatatcaacacaaaacatccagac
tttgctgatgcttgtgggctaatgaacaataatatagaggaacaaaggagaaacaggcta
gccagagaattaccttcagctgtatcacgagacaagtcttctaaagttccaagtgctttg
gcacctgcctcccaggagccctcccccgctgcttctgctgaggctgatggcaaggttgca
tctggaggtggtggggttggagatggtgttcaagaaccaaccacaggcaactggagagga
atgctgaaaacttcaaaagctgaagagttattagcagaagaaaaatcaaaacccattcca
attatgccagccagtccacaaaaaggtcatgccgtgaacctgctagatgtgccagttcct
gttgcacgaaaactatctgctcgggaacagcgagattgtgaggttattgaacgactcatt
aaatcatattttctcattgtcagaaagaatattcaagacagtgtgccaaaggcagtaatg
cattttttggttaatcatgtgaaagacactcttcagagtgagctagtaggccagctgtat
aaatcatccttattggatgatcttctgacagaatctgaggacatggcacagcgcaggaaa
gaagcagctgatatgctaaaggcattacaaggagccagtcaaattattgctgaaatccgg
gagactcatctttggtga

DBGET integrated database retrieval system