KEGG   Homo sapiens (human): 10062Help
Entry
10062             CDS       T01001                                 

Gene name
NR1H3, LXR-a, LXRA, RLD-1
Definition
nuclear receptor subfamily 1, group H, member 3
Orthology
K08536  
liver X receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    10062 (NR1H3)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    10062 (NR1H3)
  Infectious diseases
   05160 Hepatitis C
    10062 (NR1H3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    10062 (NR1H3)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   10062 (NR1H3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p11.2
AA seq 387 aa AA seqDB search
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgtggctgggggcccctgtgcctgacattcctcctgactctgcggtggagctg
tggaagccaggcgcacaggatgcaagcagccaggcccagggaggcagcagctgcatcctc
agagaggaagccaggatgccccactctgctgggggtactgcaggggtggggctggaggct
gcagagcccacagccctgctcaccagggcagagcccccttcagaacccacagagatccgt
ccacaaaagcggaaaaaggggccagcccccaaaatgctggggaacgagctatgcagcgtg
tgtggggacaaggcctcgggcttccactacaatgttctgagctgcgagggctgcaaggga
ttcttccgccgcagcgtcatcaagggagcgcactacatctgccacagtggcggccactgc
cccatggacacctacatgcgtcgcaagtgccaggagtgtcggcttcgcaaatgccgtcag
gctggcatgcgggaggagtgtgtcctgtcagaagaacagatccgcctgaagaaactgaag
cggcaagaggaggaacaggctcatgccacatccttgccccccagggcttcctcacccccc
caaatcctgccccagctcagcccggaacaactgggcatgatcgagaagctcgtcgctgcc
cagcaacagtgtaaccggcgctccttttctgaccggcttcgagtcacggtgatgcttctg
gagacatctcggaggtacaaccctgggagtgagagtatcaccttcctcaaggatttcagt
tataaccgggaagactttgccaaagcagggctgcaagtggaattcatcaaccccatcttc
gagttctccagggccatgaatgagctgcaactcaatgatgccgagtttgccttgctcatt
gctatcagcatcttctctgcagaccggcccaacgtgcaggaccagctccaggtagagagg
ctgcagcacacatatgtggaagccctgcatgcctacgtctccatccaccatccccatgac
cgactgatgttcccacggatgctaatgaaactggtgagcctccggaccctgagcagcgtc
cactcagagcaagtgtttgcactgcgtctgcaggacaaaaagctcccaccgctgctctct
gagatctgggatgtgcacgaatga

DBGET integrated database retrieval system