KEGG   Homo sapiens (human): 10063Help
Entry
10063             CDS       T01001                                 

Gene name
COX17
Definition
COX17 cytochrome c oxidase copper chaperone
Orthology
K02260  
cytochrome c oxidase assembly protein subunit 17
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    10063 (COX17)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    10063 (COX17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q13.33
AA seq 63 aa AA seqDB search
MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG
FKI
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgccgggtctggttgactcaaaccctgccccgcctgagtctcaggagaagaagccgctg
aagccctgctgcgcttgcccggagaccaagaaggcgcgcgatgcgtgtatcatcgagaaa
ggagaagaacactgtggacatctaattgaggcccacaaggaatgcatgagagccctagga
tttaaaatatga

DBGET integrated database retrieval system