KEGG   Homo sapiens (human): 10076Help
Entry
10076             CDS       T01001                                 

Gene name
PTPRU, FMI, PCP-2, PTP, PTP-J, PTP-PI, PTP-RO, PTPPSI, PTPRO, PTPU2, R-PTP-PSI, R-PTP-U, hPTP-J
Definition
(RefSeq) protein tyrosine phosphatase, receptor type U (EC:3.1.3.48)
  KO
K16662  
receptor-type tyrosine-protein phosphatase U [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     10076 (PTPRU)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    10076 (PTPRU)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRU; receptor-type tyrosine-protein phosphatase U [KO:K16662]
     10076 (PTPRU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p35.3
AA seq 1446 aa AA seqDB search
MARAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGT
RAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVY
VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDIL
LLSYPCAKAPHFSRLGDVEVNAGQNASFQCMAAGRAAEAERFLLQRQSGALVPAAGVRHI
SHRRFLATFPLAAVSRAEQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPT
YLIIQLNTNSIIGDGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLT
RPGDGGTGRPGPPLISRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVS
LCYHYTLGSSHNQTIRECVKTEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQ
TDEDVPSGIAAESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPR
RTISKLRNETYHVFSNLHPGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSP
LGESENTITVLLRPAQGRGAPISVYQVIVEEERARRLRREPGGQDCFPVPLTFEAALARG
LVHYFGAELAASSLPEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNC
IRIARKAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVIIRKGRDHYAYS
YYPKPVNMTKATVNYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDTHGYSTRGDQRS
GGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYES
FFEGWDATKKKDKVKGSRQEPMPAYDRHRVKLHPMLGDPNADYINANYIDGYHRSNHFIA
TQGPKPEMVYDFWRMVWQEHCSSIVMITKLVEVGRVKCSRYWPEDSDTYGDIKIMLVKTE
TLAEYVVRTFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGP
IVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDA
ILEACLCGETTIPVSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALL
PRNRDKNRSMDVLPPDRCLPFLISTDGDSNNYINAALTDSYTRSAAFIVTLHPLQSTTPD
FWRLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFMSGTADEDLVARV
FRVQNISRLQEGHLLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAESGDGRTIVHC
LNGGGRSGTFCACATVLEMIRCHNLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYL
EGLESR
NT seq 4341 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtgcccaggcgctcgtgctggcactcaccttccagctctgcgcgccggagacc
gagactccggcagctggctgcaccttcgaggaggcaagtgacccagcagtgccctgcgag
tacagccaggcccagtacgatgacttccagtgggagcaagtgcgaatccaccctggcacc
cgggcacctgcggacctgccccacggctcctacttgatggtcaacacttcccagcatgcc
ccaggccagcgagcccatgtcatcttccagagcctgagcgagaatgatacccactgtgtg
cagttcagctacttcctgtacagccgggacgggcacagcccgggcaccctgggcgtctac
gtgcgcgttaatgggggccccctgggcagtgctgtgtggaatatgactggatcccacggc
cgtcagtggcaccaggctgagctggctgtcagcactttctggcccaatgaatatcaggtg
ctgtttgaggccctcatctccccagaccgcaggggctacatgggcctagatgacatcctg
cttctcagctacccctgcgcaaaggccccacacttctcccgcctgggcgacgtggaggtc
aacgcgggccagaacgcgtcgttccagtgcatggccgcgggcagagcggccgaggccgaa
cgcttcctcttgcaacggcagagcggggcgctggtgccggcggcgggcgtgcggcacatc
agccaccggcgcttcctggccactttcccgctggctgccgtgagccgcgccgagcaggac
ctgtaccgctgtgtgtcccaggccccgcgcggcgcgggcgtctctaacttcgcggagctc
atcgtcaaggagcccccaactcccatcgcgcccccacagctgctgcgtgctggccccacc
tacctcatcatccagctcaacaccaactccatcattggcgacgggccgatcgtgcgcaag
gagattgagtaccgcatggcgcgcgggccctgggctgaggtgcacgccgtcagcctgcag
acctacaagctgtggcacctcgaccccgacacagagtatgagatcagcgtgctgctcacg
cgtcccggagacggcggcactggccgccctgggccacccctcatcagccgcaccaaatgc
gcagagcccatgagggcccccaaaggcctggcttttgctgagatccaggcccgtcagctg
accctgcagtgggaaccactgggctacaacgtgacgcgttgccacacctatactgtgtcg
ctgtgctatcactacaccctgggcagcagccacaaccagaccatccgagagtgtgtgaag
acagagcaaggtgtcagccgctacaccatcaagaacctgctgccctatcggaacgttcac
gtgaggcttgtcctcactaaccctgaggggcgcaaagagggcaaggaggtcactttccag
acggatgaggatgtgcccagtgggattgcagccgagtccctgaccttcactccactggag
gacatgatcttcctcaagtgggaggagccccaggagcccaatggtctcatcacccagtat
gagatcagctaccagagcatcgagtcatcagacccggcagtgaacgtgccaggcccacga
cgtaccatctccaagctccgcaatgagacctaccatgtcttctccaacctgcacccaggc
accacctacctgttctccgtgcgggcccgcacaggcaaaggcttcggccaggcggcactc
actgagataaccactaacatctctgctcccagctttgattatgccgacatgccgtcaccc
ctgggcgagtctgagaacaccatcaccgtgctgctgaggccggcacagggccgcggtgcg
cccatcagtgtgtaccaggtgattgtggaggaggagcgggcgcggaggctgcggcgggag
ccaggtggacaggactgcttcccagtgccattgaccttcgaggcggcgctggcccgaggc
ctggtgcactacttcggggccgaactggcggccagcagtctacctgaggccatgcccttt
accgtgggtgacaaccagacctaccgaggcttctggaacccaccacttgagcctaggaag
gcctatctcatctacttccaggcagcaagccacctgaagggggagacccggctgaattgc
atccgcattgccaggaaagctgcctgcaaggaaagcaagcggcccctggaggtgtcccag
agatcggaggagatggggcttatcctgggcatctgtgcaggggggcttgctgtcctcatc
cttctcctgggtgccatcattgtcatcatccgcaaagggagagaccactatgcctactcc
tactacccgaagccggtgaacatgaccaaggccaccgtcaactaccgccaggagaagaca
cacatgatgagcgccgtggaccgcagcttcacagaccagagcaccctgcaggaggacgag
cggctgggcctgtccttcatggacacccatggctacagcacccggggagaccagcgcagc
ggtggggtcactgaggccagcagcctcctggggggctccccgaggcgtccctgtggccgg
aagggctccccataccacacggggcagctgcaccctgcggtgcgtgtcgcagaccttctg
cagcacatcaaccagatgaagacggccgagggttacggcttcaagcaggagtatgagagc
ttctttgaaggctgggacgccacaaagaagaaagacaaggtcaagggcagccggcaggag
ccaatgcctgcctatgatcggcaccgagtgaaactgcacccgatgctgggagaccccaat
gccgactacattaatgccaactacatagatggttaccacaggtcaaaccacttcatagcc
actcaagggccgaagcctgagatggtctatgacttctggcgtatggtgtggcaggagcac
tgttccagcatcgtcatgatcaccaagctggtcgaggtgggcagggtgaaatgctcacgg
tactggccggaggactcagacacctacggggacatcaagattatgctggtgaagacagag
accctggctgagtatgtcgtgcgcacttttgccctggagcggagaggctactctgcccgg
cacgaggtccgccagttccacttcacagcgtggccagagcatggcgtcccctaccatgcc
acggggctgctggctttcatccggcgcgtgaaggcctccaccccacctgatgccgggccc
attgtcatccactgcagcgcgggcaccggccgcacaggttgctatatcgtcctggatgtg
atgctggacatggcagagtgtgagggcgtcgtggacatttacaactgtgtgaagactctc
tgctcccggcgtgtcaacatgatccagactgaggagcagtacatcttcattcatgatgca
atcctggaggcctgcctgtgtggggagaccaccatccctgtcagtgagttcaaggccacc
tacaaggagatgatccgcattgatcctcagagtaattcctcccagctgcgggaagagttc
cagacgctgaactcggtcaccccgccgctggacgtggaggagtgcagcatcgccctgttg
ccccggaaccgcgacaagaaccgcagcatggacgtcctgccgcccgaccgctgcctgccc
ttcctcatctccactgatggggactccaacaactacattaatgcagccctgactgacagc
tacacacggagtgcggccttcatcgtgaccctgcacccgctgcagagcaccacgcccgac
ttctggcggctggtctacgattacgggtgcacctccatcgtcatgctcaaccagctgaac
cagtccaactccgcctggccctgcctgcagtactggccagagccaggccggcagcaatat
ggcctcatggaggtggagtttatgtcgggcacagctgatgaagacttagtggctcgagtc
ttccgggtgcagaacatctctcggttgcaggaggggcacctgctggtgcggcacttccag
ttcctgcgctggtctgcataccgggacacacctgactccaagaaggccttcttgcacctg
ctggctgaggtggacaagtggcaggccgagagtggggatgggcgcaccatcgtgcactgc
ctaaacgggggaggacgcagcggcaccttctgcgcctgcgccacggtcctggagatgatc
cgctgccacaacttggtggacgttttctttgctgccaaaaccctccggaactacaaaccc
aacatggtggagaccatggatcagtaccacttttgctacgatgtggccctggagtacttg
gaggggctggagtcaagatag

DBGET integrated database retrieval system