KEGG   Homo sapiens (human): 10090Help
Entry
10090             CDS       T01001                                 

Gene name
UST, 2OST
Definition
uronyl-2-sulfotransferase
Orthology
K03193  
dermatan/chondrotin sulfate uronyl 2-O-sulfotransferase UST [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate [PATH:hsa00532]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q25.1
AA seq 406 aa AA seqDB search
MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCL
GSLLYQLSGGPPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL
LLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFGGD
QPVYINIIRDPVNRFLSNYFFRRFGDWRGEQNHMIRTPSMRQEERYLDINECILENYPEC
SNPRLFYIIPYFCGQHPRCREPGEWALERAKLNVNENFLLVGILEELEDVLLLLERFLPH
YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHYVKEQFHLLKR
KFGLKSHVSKPPLRPHFFIPTPLETEEPIDDEEQDDEKWLEDIYKR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaagcagcagcatcccggcggcggcgcggatccctggccccatggggcccct
atggggggcgcccctccgggcctgggcagctggaagcgtcgggtgcccctgctgcctttc
ctgcgcttctccctccgggactacggcttctgcatggccaccctgctggtcttctgcctg
ggctccctcctctatcagctcagcgggggaccccctcgcttcctgctcgacctgcggcag
tacttgggaaattccacttacttggatgaccatggaccacctcctagtaaggtactacct
ttcccaagccaggtggtgtacaacagggtaggcaagtgtgggagccgtactgtggtcttg
cttctgagaatcttgtcggagaagcacggatttaatttggtcacatcagacattcacaac
aaaaccaggcttactaaaaatgaacaaatggaactgattaaaaatataagtactgccgaa
caaccctatttattcactcgacatgttcatttcctcaacttctcaaggtttggaggagac
cagcctgtctacatcaacatcattagagaccccgtcaaccggttcttatccaactatttt
ttccgtcgctttggagactggagaggggaacaaaatcacatgatccgcacccccagcatg
aggcaggaggagcgctacctggatatcaatgagtgtattcttgaaaactatcccgagtgc
tccaaccccaggttattttacatcattccgtacttttgtggacagcatcccagatgcagg
gagcctggtgaatgggcccttgagagagcaaagctgaacgtgaatgaaaacttcctgctc
gtggggattcttgaagagttggaagatgtgctgctgttactggaaagatttttacctcat
tacttcaagggcgtgctcagtatctacaaagacccagagcacaggaagcttggaaacatg
actgtgacggtgaagaagactgtcccctctcctgaggctgtgcagatcctctaccagcgg
atgagatacgagtacgagttttaccactacgtcaaagagcagttccacctgctgaagcgc
aagtttggacttaagtctcacgtcagcaagccccccctgaggccacacttctttatccca
actccactggaaaccgaggagccaatcgacgatgaagaacaggatgatgaaaagtggctg
gaagatatttataagaggtga

DBGET integrated database retrieval system