KEGG   Homo sapiens (human): 10092Help
Entry
10092             CDS       T01001                                 

Gene name
ARPC5, ARC16, dJ127C7.3, p16-Arc
Definition
actin related protein 2/3 complex, subunit 5, 16kDa
Orthology
K05754  
actin related protein 2/3 complex, subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10092 (ARPC5)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    10092 (ARPC5)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10092 (ARPC5)
   05132 Salmonella infection
    10092 (ARPC5)
   05131 Shigellosis
    10092 (ARPC5)
   05100 Bacterial invasion of epithelial cells
    10092 (ARPC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25.3
AA seq 154 aa AA seqDB search
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQA
ALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESP
SDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacacagtgtcgtcggcccgcttccggaaggtggacgtggatgaatatgac
gagaacaagttcgtggacgaagaagatgggggcgacggccaggccgggcccgacgagggc
gaggtggactcctgcctgcggcattccatcacaggaaacatgacagctgccctacaggca
gctctgaagaacccccctatcaacaccaagagtcaggcagtgaaggaccgggcaggcagc
attgtcttgaaggtgctcatctcttttaaagctaatgatatagaaaaggcagttcaatct
ctggacaagaatggtgtggatctcctaatgaagtatatttataaaggatttgagagcccg
tctgacaatagcagtgctatgttactgcaatggcatgaaaaggcacttgctgctggagga
gtagggtccattgttcgtgtcttgactgcaagaaaaactgtgtag

DBGET integrated database retrieval system