KEGG   Homo sapiens (human): 10092Help
Entry
10092             CDS       T01001                                 

Gene name
ARPC5, ARC16, dJ127C7.3, p16-Arc
Definition
(RefSeq) actin related protein 2/3 complex subunit 5
  KO
K05754  
actin related protein 2/3 complex, subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    10092 (ARPC5)
  Cell motility
   04810 Regulation of actin cytoskeleton
    10092 (ARPC5)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    10092 (ARPC5)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10092 (ARPC5)
   05132 Salmonella infection
    10092 (ARPC5)
   05131 Shigellosis
    10092 (ARPC5)
   05100 Bacterial invasion of epithelial cells
    10092 (ARPC5)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10092 (ARPC5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10092 (ARPC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25.3
AA seq 151 aa AA seqDB search
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALK
NPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDN
SSAMLLQWHEKALAAGGVGSIVRVLTARKTV
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacacagtgtcgtcggcccgcttccggaaggtggacgtggatgaatatgac
gagaacaagttcgtggacgaagaagatgggggcgacggccaggccgggcccgacgagggc
gaggtggactcctgcctgcggcaaggaaacatgacagctgccctacaggcagctctgaag
aacccccctatcaacaccaagagtcaggcagtgaaggaccgggcaggcagcattgtcttg
aaggtgctcatctcttttaaagctaatgatatagaaaaggcagttcaatctctggacaag
aatggtgtggatctcctaatgaagtatatttataaaggatttgagagcccgtctgacaat
agcagtgctatgttactgcaatggcatgaaaaggcacttgctgctggaggagtagggtcc
attgttcgtgtcttgactgcaagaaaaactgtgtag

DBGET integrated database retrieval system