KEGG   Homo sapiens (human): 10092Help
Entry
10092             CDS       T01001                                 

Gene name
ARPC5, ARC16, dJ127C7.3, p16-Arc
Definition
actin related protein 2/3 complex, subunit 5, 16kDa
Orthology
K05754  
actin related protein 2/3 complex, subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25.3
AA seq 154 aa AA seqDB search
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQA
ALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESP
SDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacacagtgtcgtcggcccgcttccggaaggtggacgtggatgaatatgac
gagaacaagttcgtggacgaagaagatgggggcgacggccaggccgggcccgacgagggc
gaggtggactcctgcctgcggcattccatcacaggaaacatgacagctgccctacaggca
gctctgaagaacccccctatcaacaccaagagtcaggcagtgaaggaccgggcaggcagc
attgtcttgaaggtgctcatctcttttaaagctaatgatatagaaaaggcagttcaatct
ctggacaagaatggtgtggatctcctaatgaagtatatttataaaggatttgagagcccg
tctgacaatagcagtgctatgttactgcaatggcatgaaaaggcacttgctgctggagga
gtagggtccattgttcgtgtcttgactgcaagaaaaactgtgtag

DBGET integrated database retrieval system