KEGG   Homo sapiens (human): 10093Help
Entry
10093             CDS       T01001                                 

Gene name
ARPC4, ARC20, P20-ARC
Definition
actin related protein 2/3 complex, subunit 4, 20kDa
Orthology
K05755  
actin related protein 2/3 complex, subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10093 (ARPC4)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    10093 (ARPC4)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10093 (ARPC4)
   05132 Salmonella infection
    10093 (ARPC4)
   05131 Shigellosis
    10093 (ARPC4)
   05100 Bacterial invasion of epithelial cells
    10093 (ARPC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3p25.3
AA seq 78 aa AA seqDB search
MRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMK
LSVNARARIVAEEFLKNF
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcatgatgatgcgagcagagaacttctttatccttcgaaggaagcctgtggag
gggtatgatatcagctttctgatcaccaacttccacacagagcagatgtacaaacacaag
ttggtggactttgtgatccacttcatggaggagattgacaaggagatcagtgagatgaag
ctgtcagtcaatgcccgtgcccgcattgtggctgaagagttccttaagaatttttaa

DBGET integrated database retrieval system