KEGG   Homo sapiens (human): 10093Help
Entry
10093             CDS       T01001                                 

Gene name
ARPC4, ARC20, P20-ARC
Definition
(RefSeq) actin related protein 2/3 complex subunit 4
  KO
K05755  
actin related protein 2/3 complex, subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    10093 (ARPC4)
  Cell motility
   04810 Regulation of actin cytoskeleton
    10093 (ARPC4)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    10093 (ARPC4)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10093 (ARPC4)
   05132 Salmonella infection
    10093 (ARPC4)
   05131 Shigellosis
    10093 (ARPC4)
   05100 Bacterial invasion of epithelial cells
    10093 (ARPC4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10093 (ARPC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
3p25.3
AA seq 168 aa AA seqDB search
MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEK
VLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITN
FHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgactgccactctccgcccctacctgagtgccgtgcgggccacattgcaggctgccctc
tgcctggagaacttctcctcccaggttgtggaacgacacaacaagccggaagtggaagtc
aggagtagcaaagagctcctgttacaacctgtgaccatcagcaggaatgagaaggaaaag
gttctgattgagggctccatcaactctgtccgggtcagcattgctgtgaaacaggctgat
gagatcgagaagattttgtgccacaagttcatgcgcttcatgatgatgcgagcagagaac
ttctttatccttcgaaggaagcctgtggaggggtatgatatcagctttctgatcaccaac
ttccacacagagcagatgtacaaacacaagttggtggactttgtgatccacttcatggag
gagattgacaaggagatcagtgagatgaagctgtcagtcaatgcccgtgcccgcattgtg
gctgaagagttccttaagaatttttaa

DBGET integrated database retrieval system