KEGG   Homo sapiens (human): 10094Help
Entry
10094             CDS       T01001                                 

Gene name
ARPC3, ARC21, p21-Arc
Definition
actin related protein 2/3 complex, subunit 3, 21kDa
Orthology
K05756  
actin related protein 2/3 complex, subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.11
AA seq 178 aa AA seqDB search
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEI
KNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
ANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccggcttaccactcttctctcatggatcctgataccaaactcatcggaaacatggca
ctgttgcctatcagaagtcaattcaaaggacctgcccccagagagacaaaagatacagat
attgtggatgaagccatctattacttcaaggccaatgtcttcttcaaaaactatgaaatt
aagaatgaagctgataggaccttgatatatataactctctacatttctgaatgtctgaag
aaactgcaaaagtgcaattccaaaagccaaggtgagaaagaaatgtatacgctgggaatc
actaattttcccattcctggagagcctggttttccacttaacgcaatttatgccaaacct
gcaaacaaacaggaagatgaagtgatgagagcctatttacaacagctaaggcaagagact
ggactgagactttgtgagaaagttttcgaccctcagaatgataaacccagcaagtggtgg
acttgctttgtgaagagacagttcatgaacaagagtctttcaggacctggacagtga

DBGET integrated database retrieval system