KEGG   Homo sapiens (human): 10094Help
Entry
10094             CDS       T01001                                 

Gene name
ARPC3, ARC21, p21-Arc
Definition
actin related protein 2/3 complex, subunit 3, 21kDa
Orthology
K05756  
actin related protein 2/3 complex, subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10094 (ARPC3)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    10094 (ARPC3)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10094 (ARPC3)
   05132 Salmonella infection
    10094 (ARPC3)
   05131 Shigellosis
    10094 (ARPC3)
   05100 Bacterial invasion of epithelial cells
    10094 (ARPC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.11
AA seq 178 aa AA seqDB search
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEI
KNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
ANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccggcttaccactcttctctcatggatcctgataccaaactcatcggaaacatggca
ctgttgcctatcagaagtcaattcaaaggacctgcccccagagagacaaaagatacagat
attgtggatgaagccatctattacttcaaggccaatgtcttcttcaaaaactatgaaatt
aagaatgaagctgataggaccttgatatatataactctctacatttctgaatgtctgaag
aaactgcaaaagtgcaattccaaaagccaaggtgagaaagaaatgtatacgctgggaatc
actaattttcccattcctggagagcctggttttccacttaacgcaatttatgccaaacct
gcaaacaaacaggaagatgaagtgatgagagcctatttacaacagctaaggcaagagact
ggactgagactttgtgagaaagttttcgaccctcagaatgataaacccagcaagtggtgg
acttgctttgtgaagagacagttcatgaacaagagtctttcaggacctggacagtga

DBGET integrated database retrieval system