KEGG   Homo sapiens (human): 10102Help
Entry
10102             CDS       T01001                                 

Gene name
TSFM, EFTS, EFTSMT
Definition
(RefSeq) Ts translation elongation factor, mitochondrial
  KO
K02357  
elongation factor Ts
Organism
hsa  Homo sapiens (human)
Disease
H00891  
Combined oxidative phosphorylation deficiency (COXPD)
Brite
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Elongation factors
   10102 (TSFM)
 Prokaryotic Type
   10102 (TSFM)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    10102 (TSFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q14.1
AA seq 325 aa AA seqDB search
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVE
VNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREG
SLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGALVIC
ETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYV
QPQGVSVVDFVRFECGEGEEAAETE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgctgcggtcgctgcgcgtgtttctggtcgcgcggaccgggagctacccggct
gggtctcttctgcgtcagtcgccccagccaaggcacacattttatgctgggccccgtctg
tctgcctcggcctccagcaaggagctcctcatgaagctgcggcggaaaacaggctactcc
tttgtaaattgcaagaaagctctggagacttgtggcggggacctcaaacaggcagagatc
tggctccacaaggaggcccagaaggagggctggagcaaagctgccaagctccaagggagg
aagaccaaagaaggcctgattgggctgttgcaggaaggaaacacaactgtattagtagag
gtaaactgtgagacagattttgtttctagaaatttaaaatttcaactgttggtccagcaa
gtagcccttggaaccatgatgcattgtcagaccctaaaggatcaaccctctgcatacagt
aaaggtttcttgaattcctctgagctttctggacttccagctgggcctgacagagaaggc
tcactcaaggatcagttggctttagcaattggaaaactgggagaaaacatgattcttaaa
cgagctgcatgggtgaaggtgccatctgggttctacgttggctcttatgtccacggagca
atgcagagtccctcacttcacaagctggtgctggggaagtatggggccctggtcatctgt
gagacgtctgaacagaaaacaaaccttgaagacgttggccgccgccttgggcagcatgtg
gtgggcatggcccccctctctgttggctccctggacgatgagcctgggggagaggcagag
actaagatgctgtcccagccgtatttgctggatccctccattaccttggggcagtatgtg
cagcctcagggggtgtcggtagtagactttgtgcggtttgaatgtggagaaggtgaagag
gcagcagaaactgaatag

DBGET integrated database retrieval system