KEGG   Homo sapiens (human): 10102Help
Entry
10102             CDS       T01001                                 

Gene name
TSFM, EFTS, EFTSMT
Definition
Ts translation elongation factor, mitochondrial
Orthology
K02357  
elongation factor Ts
Organism
hsa  Homo sapiens (human)
Disease
H00891  
Combined oxidative phosphorylation deficiency (COXPD)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    10102 (TSFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q14.1
AA seq 167 aa AA seqDB search
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVE
VNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKENWEKT
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgctgcggtcgctgcgcgtgtttctggtcgcgcggaccgggagctacccggct
gggtctcttctgcgtcagtcgccccagccaaggcacacattttatgctgggccccgtctg
tctgcctcggcctccagcaaggagctcctcatgaagctgcggcggaaaacaggctactcc
tttgtaaattgcaagaaagctctggagacttgtggcggggacctcaaacaggcagagatc
tggctccacaaggaggcccagaaggagggctggagcaaagctgccaagctccaagggagg
aagaccaaagaaggcctgattgggctgttgcaggaaggaaacacaactgtattagtagag
gtaaactgtgagacagattttgtttctagaaatttaaaatttcaactgttggtccagcaa
gtagcccttggaaccatgatgcattgtcagaccctaaaggatcaaccctctgcatacagt
aaagaaaactgggagaaaacatga

DBGET integrated database retrieval system