KEGG   Homo sapiens (human): 10105Help
Entry
10105             CDS       T01001                                 

Gene name
PPIF, CYP3, CyP-M, Cyp-D, CypD
Definition
peptidylprolyl isomerase F (EC:5.2.1.8)
Orthology
K09565  
peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Parkinson's disease
Huntington's disease
Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    10105 (PPIF)
   04022 cGMP - PKG signaling pathway
    10105 (PPIF)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    10105 (PPIF)
   05016 Huntington's disease
    10105 (PPIF)
  Infectious diseases
   05145 Toxoplasmosis
    10105 (PPIF)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     10105 (PPIF)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    10105 (PPIF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q22-q23
AA seq 207 aa AA seqDB search
MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLG
RVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSI
YGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDV
VKKIESFGSKSGRTSKKIVITDCGQLS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctgcgctgcggctcccgctggctcggcctgctctccgtcccgcgctccgtg
ccgctgcgcctccccgcggcccgcgcctgcagcaagggctccggcgacccgtcctcttcc
tcctcctccgggaacccgctcgtgtacctggacgtggacgccaacgggaagccgctcggc
cgcgtggtgctggagctgaaggcagatgtcgtcccaaagacagctgagaacttcagagcc
ctgtgcactggtgagaagggcttcggctacaaaggctccaccttccacagggtgatccct
tccttcatgtgccaggcgggcgacttcaccaaccacaatggcacaggcgggaagtccatc
tacggaagccgctttcctgacgagaactttacactgaagcacgtggggccaggtgtcctg
tccatggctaatgctggtcctaacaccaacggctcccagttcttcatctgcaccataaag
acagactggttggatggcaagcatgttgtgttcggtcacgtcaaagagggcatggacgtc
gtgaagaaaatagaatctttcggctctaagagtgggaggacatccaagaagattgtcatc
acagactgtggccagttgagctaa

DBGET integrated database retrieval system