KEGG   Homo sapiens (human): 10105Help
Entry
10105             CDS       T01001                                 

Gene name
PPIF, CYP3, CyP-M, Cyp-D, CypD
Definition
(RefSeq) peptidylprolyl isomerase F
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
hsa05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    10105 (PPIF)
   04022 cGMP - PKG signaling pathway
    10105 (PPIF)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    10105 (PPIF)
   05016 Huntington's disease
    10105 (PPIF)
  Infectious diseases
   05145 Toxoplasmosis
    10105 (PPIF)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     10105 (PPIF)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    10105 (PPIF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 10105
NCBI-ProteinID: NP_005720
OMIM: 604486
HGNC: 9259
Ensembl: ENSG00000108179
Vega: OTTHUMG00000018562
Pharos: P30405(Tchem)
UniProt: P30405 A0A024QZS4
Structure
PDB: 

Jmol
Position
10q22.3
AA seq 207 aa AA seqDB search
MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLG
RVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSI
YGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDV
VKKIESFGSKSGRTSKKIVITDCGQLS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctgcgctgcggctcccgctggctcggcctgctctccgtcccgcgctccgtg
ccgctgcgcctccccgcggcccgcgcctgcagcaagggctccggcgacccgtcctcttcc
tcctcctccgggaacccgctcgtgtacctggacgtggacgccaacgggaagccgctcggc
cgcgtggtgctggagctgaaggcagatgtcgtcccaaagacagctgagaacttcagagcc
ctgtgcactggtgagaagggcttcggctacaaaggctccaccttccacagggtgatccct
tccttcatgtgccaggcgggcgacttcaccaaccacaatggcacaggcgggaagtccatc
tacggaagccgctttcctgacgagaactttacactgaagcacgtggggccaggtgtcctg
tccatggctaatgctggtcctaacaccaacggctcccagttcttcatctgcaccataaag
acagactggttggatggcaagcatgttgtgttcggtcacgtcaaagagggcatggacgtc
gtgaagaaaatagaatctttcggctctaagagtgggaggacatccaagaagattgtcatc
acagactgtggccagttgagctaa

DBGET integrated database retrieval system