KEGG   Homo sapiens (human): 1012Help
Entry
1012              CDS       T01001                                 

Gene name
CDH13, CDHH, P105
Definition
cadherin 13 (EC:3.6.1.3)
Orthology
K06808  
cadherin 13, H-cadherin
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q23.3
AA seq 760 aa AA seqDB search
MKTPPGASSRTKCSRELRSFCAFSCPRAKQPTCTAWFPQQEHPSENGPQMPGRDPPAAST
MQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKGNDKLRYEVSSPYF
KVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGSLQDIFKFARTSPV
PRQKRSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGVDQEPKGIFRINEN
TGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIFREGPYIGH
VMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFYIDPEKGDIVTVVS
PALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKKEFQATVE
EGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTNEGMLSVVKPLDYE
ISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDLSVG
SVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVDNSVYTA
LFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHP
NTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNIT
DLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLACL
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgccgccgggcgcttctagtcggacaaaatgcagccgagaactccgctcgttc
tgtgcgttctcctgtcccagggccaaacaacccacctgcactgcatggttcccccagcaa
gaacatcccagtgagaatggcccacagatgcctgggcgtgacccacctgcagcttcaacc
atgcaggtgctgctgctaacatctgcagaagatttggactgcactcctggatttcagcag
aaagtgttccatatcaatcagccagctgaattcattgaggaccagtcaattctaaacttg
accttcagtgactgtaagggaaacgacaagctacgctatgaggtctcgagcccatacttc
aaggtgaacagcgatggcggcttagttgctctgagaaacataactgcagtgggcaaaact
ctgttcgtccatgcacggaccccccatgcggaagatatggcagaactcgtgattgtcggg
gggaaagacatccagggctccttgcaggatatatttaaatttgcaagaacttctcctgtc
ccaagacaaaagaggtccattgtggtatctcccattttaattccagagaatcagagacag
cctttcccaagagatgttggcaaggtagtcgatagtgacaggccagaaaggtccaagttc
cggctcactggaaagggagtggatcaagagcctaaaggaattttcagaatcaatgagaac
acagggagcgtctccgtgacacggaccttggacagagaagtaatcgctgtttatcaacta
tttgtggagaccactgatgtcaatggcaaaactctcgaggggccggtgcctctggaagtc
attgtgattgatcagaatgacaaccgaccgatctttcgggaaggcccctacatcggccac
gtcatggaagggtcacccacaggcaccacagtgatgcggatgacagcctttgatgcagat
gacccagccaccgataatgccctcctgcggtataatatccgtcagcagacgcctgacaag
ccatctcccaacatgttctacatcgatcctgagaaaggagacattgtcactgttgtgtca
cctgcgctgctggaccgagagactctggaaaatcccaagtatgaactgatcatcgaggct
caagatatggctggactggatgttggattaacaggcacggccacagccacgatcatgatc
gatgacaaaaatgatcactcaccaaaattcaccaagaaagagtttcaagccacagtcgag
gaaggagctgtgggagttattgtcaatttgacagttgaagataaggatgaccccaccaca
ggtgcatggagggctgcctacaccatcatcaacggaaaccccgggcagagctttgaaatc
cacaccaaccctcaaaccaacgaagggatgctttctgttgtcaaaccattggactatgaa
atttctgccttccacaccctgctgatcaaagtggaaaatgaagacccactcgtacccgac
gtctcctacggccccagctccacagccaccgtccacatcactgtcctggatgtcaacgag
ggcccagtcttctacccagaccccatgatggtgaccaggcaggaggacctctctgtgggc
agcgtgctgctgacagtgaatgccacggaccccgactccctgcagcatcaaaccatcagg
tattctgtttacaaggacccagcaggttggctgaatattaaccccatcaatgggactgtt
gacaccacagctgtgctggaccgtgagtccccatttgtcgacaacagcgtgtacactgct
ctcttcctggcaattgacagtggcaaccctcccgctacgggcactgggactttgctgata
accctggaggacgtgaatgacaatgccccgttcatttaccccacagtagctgaagtctgt
gatgatgccaaaaacctcagtgtagtcattttgggagcatcagataaggatcttcacccg
aatacagatcctttcaaatttgaaatccacaaacaagctgttcctgataaagtctggaag
atctccaagatcaacaatacacacgccctggtaagccttcttcaaaatctgaacaaagca
aactacaacctgcccatcatggtgacagattcagggaaaccacccatgacgaatatcaca
gatctcagggtacaagtgtgctcctgcaggaattccaaagtggactgcaacgcggcaggg
gccctgcgcttcagcctgccctcagtcctgctcctcagcctcttcagcttagcttgtctg
tga

DBGET integrated database retrieval system