KEGG   Homo sapiens (human): 1012Help
Entry
1012              CDS       T01001                                 

Gene name
CDH13, CDHH, P105
Definition
(RefSeq) cadherin 13 (EC:3.6.1.3)
  KO
K06808  
cadherin 13, H-cadherin
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    1012 (CDH13)
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  Classic Cadherins
   Other classic cadherins
    CDH13; cadherin 13, H-cadherin [KO:K06808]
     1012 (CDH13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q23.3
AA seq 713 aa AA seqDB search
MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKG
NDKLRYEVSSPYFKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGS
LQDIFKFARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGV
DQEPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQND
NRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFY
IDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKNDHS
PKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTN
EGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPD
PMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLD
RESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLS
VVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIM
VTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLACL
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgagaactccgctcgttctgtgcgttctcctgtcccaggtgctgctgctaaca
tctgcagaagatttggactgcactcctggatttcagcagaaagtgttccatatcaatcag
ccagctgaattcattgaggaccagtcaattctaaacttgaccttcagtgactgtaaggga
aacgacaagctacgctatgaggtctcgagcccatacttcaaggtgaacagcgatggcggc
ttagttgctctgagaaacataactgcagtgggcaaaactctgttcgtccatgcacggacc
ccccatgcggaagatatggcagaactcgtgattgtcggggggaaagacatccagggctcc
ttgcaggatatatttaaatttgcaagaacttctcctgtcccaagacaaaagaggtccatt
gtggtatctcccattttaattccagagaatcagagacagcctttcccaagagatgttggc
aaggtagtcgatagtgacaggccagaaaggtccaagttccggctcactggaaagggagtg
gatcaagagcctaaaggaattttcagaatcaatgagaacacagggagcgtctccgtgaca
cggaccttggacagagaagtaatcgctgtttatcaactatttgtggagaccactgatgtc
aatggcaaaactctcgaggggccggtgcctctggaagtcattgtgattgatcagaatgac
aaccgaccgatctttcgggaaggcccctacatcggccacgtcatggaagggtcacccaca
ggcaccacagtgatgcggatgacagcctttgatgcagatgacccagccaccgataatgcc
ctcctgcggtataatatccgtcagcagacgcctgacaagccatctcccaacatgttctac
atcgatcctgagaaaggagacattgtcactgttgtgtcacctgcgctgctggaccgagag
actctggaaaatcccaagtatgaactgatcatcgaggctcaagatatggctggactggat
gttggattaacaggcacggccacagccacgatcatgatcgatgacaaaaatgatcactca
ccaaaattcaccaagaaagagtttcaagccacagtcgaggaaggagctgtgggagttatt
gtcaatttgacagttgaagataaggatgaccccaccacaggtgcatggagggctgcctac
accatcatcaacggaaaccccgggcagagctttgaaatccacaccaaccctcaaaccaac
gaagggatgctttctgttgtcaaaccattggactatgaaatttctgccttccacaccctg
ctgatcaaagtggaaaatgaagacccactcgtacccgacgtctcctacggccccagctcc
acagccaccgtccacatcactgtcctggatgtcaacgagggcccagtcttctacccagac
cccatgatggtgaccaggcaggaggacctctctgtgggcagcgtgctgctgacagtgaat
gccacggaccccgactccctgcagcatcaaaccatcaggtattctgtttacaaggaccca
gcaggttggctgaatattaaccccatcaatgggactgttgacaccacagctgtgctggac
cgtgagtccccatttgtcgacaacagcgtgtacactgctctcttcctggcaattgacagt
ggcaaccctcccgctacgggcactgggactttgctgataaccctggaggacgtgaatgac
aatgccccgttcatttaccccacagtagctgaagtctgtgatgatgccaaaaacctcagt
gtagtcattttgggagcatcagataaggatcttcacccgaatacagatcctttcaaattt
gaaatccacaaacaagctgttcctgataaagtctggaagatctccaagatcaacaataca
cacgccctggtaagccttcttcaaaatctgaacaaagcaaactacaacctgcccatcatg
gtgacagattcagggaaaccacccatgacgaatatcacagatctcagggtacaagtgtgc
tcctgcaggaattccaaagtggactgcaacgcggcaggggccctgcgcttcagcctgccc
tcagtcctgctcctcagcctcttcagcttagcttgtctgtga

DBGET integrated database retrieval system