KEGG   Homo sapiens (human): 10121Help
Entry
10121             CDS       T01001                                 

Gene name
ACTR1A, ARP1, Arp1A, CTRN1
Definition
(RefSeq) ARP1 actin-related protein 1 homolog A, centractin alpha
  KO
K16575  
centractin
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Dynactin complex
     10121 (ACTR1A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     10121 (ACTR1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   10121 (ACTR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24.32
AA seq 376 aa AA seqDB search
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGP
KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN
RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQ
YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGARSIHRKTF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctacgatgtgatcgccaaccagcctgtcgtgatcgacaacggatccggtgtg
attaaagctggttttgctggtgatcagatccccaaatactgctttccaaactatgtgggc
cgacccaagcacgttcgtgtcatggcaggagcccttgaaggcgacatcttcattggcccc
aaagctgaggagcaccgagggctgctttcaatccgctatcccatggagcatggcatcgtc
aaggattggaacgacatggaacgcatttggcaatatgtctattctaaggaccagctgcag
actttctcagaggagcatcctgtgctcctgactgaggcgcctttaaacccacgaaaaaac
cgggaacgagctgccgaagttttcttcgagaccttcaatgtgcccgctcttttcatctcc
atgcaagctgtactcagcctttacgctacaggcaggaccacaggggtggtgctggattct
ggggatggagtcacccatgctgtgcccatctatgagggctttgccatgccccactccatc
atgcgcatcgacatcgcgggccgggacgtctctcgcttcctgcgcctctacctgcgtaag
gagggctacgacttccactcatcctctgagtttgagattgtcaaggccataaaagaaaga
gcctgttacctatccataaacccccaaaaggatgagacgctagagacagagaaagctcag
tactacctgcctgatggcagcaccattgagattggtccttcccgattccgggcccctgag
ttgctcttcaggccagatttgattggagaggagagtgaaggcatccacgaggtcctggtg
ttcgccattcagaagtcagacatggacctgcggcgcacgcttttctctaacattgtcctc
tcaggaggctctaccctgttcaaaggttttggtgacaggctcctgagtgaagtgaagaaa
ctagctccaaaagatgtgaagatcaggatatctgcacctcaggagagactgtattccacg
tggattgggggctccatccttgcctccctggacacctttaagaagatgtgggtctccaaa
aaggaatatgaggaagacggtgcccgatccatccacagaaaaaccttctaa

DBGET integrated database retrieval system