KEGG   Homo sapiens (human): 10125Help
Entry
10125             CDS       T01001                                 

Gene name
RASGRP1, CALDAG-GEFI, CALDAG-GEFII, RASGRP, V, hRasGRP1
Definition
RAS guanyl releasing protein 1 (calcium and DAG-regulated)
Orthology
K04350  
RAS guanyl-releasing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Platelet activation
T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    10125 (RASGRP1)
   04010 MAPK signaling pathway
    10125 (RASGRP1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    10125 (RASGRP1)
   04660 T cell receptor signaling pathway
    10125 (RASGRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q14
AA seq 762 aa AA seqDB search
MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPG
LCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREG
LISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDC
GMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPN
GEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSP
RKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEI
NTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccctgggcaaggcgagagaggctccgcggaaaccttcccatggctgcagagct
gcctctaaagcaagactagaggcaaagccagccaacagccccttcccctcccatcccagc
ttggcccacatcacccagttccgaatgatggtgtctctgggacatttagccaaaggagcc
agcctggacgatctcattgacagctgcattcaatcttttgatgcagatggaaacctgtgt
cgaagtaaccaactgttgcaagtcatgctgaccatgcaccgaattgtcatctcctctgca
gaactgctccaaaaagttatcaccctctataaggatgctttggcaaagaattcaccagga
ctttgcctgaagatctgttattttgtaaggtattggataacagaattctgggtcatgttt
aaaatggacgccagcttgacagacactatggaggagtttcaggaactggtgaaagctaag
ggtgaggagttacattgccgcctgattgacacaactcaaatcaatgcccgtgactggtcc
aggaaacttactcaaaggataaaatcaaataccagcaagaaacggaaagtctccctgctc
tttgaccatctggaaccagaagagctatccgagcacctcacctaccttgagttcaagtct
ttccggaggatatcgttctctgattatcagaattaccttgtaaatagctgtgtgaaggaa
aaccccaccatggagcgatctattgctctgtgcaacggcatctcccagtgggtacaactg
atggttctcagccgccccacgccgcagctccgagcagaagtcttcatcaagttcatccag
gtggctcagaagctccaccaactacagaacttcaatacactgatggctgtgataggtggg
ctgtgtcacagctcaatctcgaggctcaaggagacaagttcgcatgtcccacatgaaatc
aataaggttctcggtgagatgactgagctgctgtcctcctccagaaactacgacaattac
cggcgagcctatggagagtgcaccgacttcaagatccccattctgggtgtgcatctcaag
gacctcatctccctgtatgaagccatgcctgactatctggaggacgggaaagtgaacgtc
cataagctactggccctatacaatcatatcagtgaattggtccagctgcaagaggtggcc
ccacccttggaggctaacaaggacttggtacacttgctgacgttatccctggatctttac
tacactgaggatgaaatctatgagctttcctatgcccgggaaccaaggaaccacagagct
ccatctgtcttcaagaactatgatcacgaccaggatggatacatttctcaggaagaattt
gaaaagattgctgcgagttttccattttccttctgtgtgatggacaaagacagggaaggc
ctcatcagcagggatgagatcacagcctacttcatgagagccagctcaatctattccaag
ctgggcctgggctttcctcacaacttccaagagaccacctacctgaagcccactttttgt
gacaactgtgctggatttctctggggagtgatcaaacaaggatatcgatgtaaagactgc
gggatgaactgtcacaaacaatgcaaagatctggttgtgtttgagtgtaagaagcgagcc
aagaacccagtagctcccacagagaacaacacttctgtggggccagtgtccaacctttgc
tcattgggagccaaagatctgctccatgcacctgaggaaggaccttttacattccctaat
ggggaggctgtggaacatggtgaggagagtaaggatcggaccatcatgctgatgggagtg
tcctcacagaagatttctcttcggctgaagagggctgttgcccacaaggccacccagact
gaatcacagccttggattggcagtgagggcccttcaggtccctttgtgctgtcttcccca
aggaagacagcccaggatactctatatgtgcttcccagtcccacctctccatgtcctagc
ccagtcttggtcagaaagcgggcttttgtcaagtgggagaataaagactccctcataaaa
tcaaaggaggagctccgtcacctcagactgcctacctaccaagaactggaacaggaaata
aatactctgaaagcagataatgatgccctaaagatccaactgaaatatgcacagaagaaa
atagaatccctccagcttgaaaaaagcaatcatgtcttagctcaaatggagcagggtgac
tgttcttag

DBGET integrated database retrieval system