KEGG   Homo sapiens (human): 10125Help
Entry
10125             CDS       T01001                                 

Gene name
RASGRP1, CALDAG-GEFI, CALDAG-GEFII, RASGRP, V, hRasGRP1
Definition
(RefSeq) RAS guanyl releasing protein 1
  KO
K04350  
RAS guanyl-releasing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Platelet activation
T cell receptor signaling pathway
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    10125 (RASGRP1)
   04010 MAPK signaling pathway
    10125 (RASGRP1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    10125 (RASGRP1)
   04660 T cell receptor signaling pathway
    10125 (RASGRP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10125 (RASGRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O95267(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
15q14
AA seq 797 aa AA seqDB search
MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPG
LCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVA
PTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKI
SLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVR
KRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQ
LEKSNHVLAQMEQGDCS
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccctgggcaaggcgagagaggctccgcggaaaccttcccatggctgcagagct
gcctctaaagcaagactagaggcaaagccagccaacagccccttcccctcccatcccagc
ttggcccacatcacccagttccgaatgatggtgtctctgggacatttagccaaaggagcc
agcctggacgatctcattgacagctgcattcaatcttttgatgcagatggaaacctgtgt
cgaagtaaccaactgttgcaagtcatgctgaccatgcaccgaattgtcatctcctctgca
gaactgctccaaaaagttatcaccctctataaggatgctttggcaaagaattcaccagga
ctttgcctgaagatctgttattttgtaaggtattggataacagaattctgggtcatgttt
aaaatggacgccagcttgacagacactatggaggagtttcaggaactggtgaaagctaag
ggtgaggagttacattgccgcctgattgacacaactcaaatcaatgcccgtgactggtcc
aggaaacttactcaaaggataaaatcaaataccagcaagaaacggaaagtctccctgctc
tttgaccatctggaaccagaagagctatccgagcacctcacctaccttgagttcaagtct
ttccggaggatatcgttctctgattatcagaattaccttgtaaatagctgtgtgaaggaa
aaccccaccatggagcgatctattgctctgtgcaacggcatctcccagtgggtacaactg
atggttctcagccgccccacgccgcagctccgagcagaagtcttcatcaagttcatccag
gtggctcagaagctccaccaactacagaacttcaatacactgatggctgtgataggtggg
ctgtgtcacagctcaatctcgaggctcaaggagacaagttcgcatgtcccacatgaaatc
aataaggttctcggtgagatgactgagctgctgtcctcctccagaaactacgacaattac
cggcgagcctatggagagtgcaccgacttcaagatccccattctgggtgtgcatctcaag
gacctcatctccctgtatgaagccatgcctgactatctggaggacgggaaagtgaacgtc
cataagctactggccctatacaatcatatcagtgaattggtccagctgcaagaggtggcc
ccacccttggaggctaacaaggacttggtacacttgctgacgttatccctggatctttac
tacactgaggatgaaatctatgagctttcctatgcccgggaaccaaggaaccacagagct
ccaccactaacaccttcaaagccaccagtagtagtggactgggcttctggagtgtctccc
aaacctgatccaaaaaccattagcaaacacgtccagaggatggtggattctgtcttcaag
aactatgatcacgaccaggatggatacatttctcaggaagaatttgaaaagattgctgcg
agttttccattttccttctgtgtgatggacaaagacagggaaggcctcatcagcagggat
gagatcacagcctacttcatgagagccagctcaatctattccaagctgggcctgggcttt
cctcacaacttccaagagaccacctacctgaagcccactttttgtgacaactgtgctgga
tttctctggggagtgatcaaacaaggatatcgatgtaaagactgcgggatgaactgtcac
aaacaatgcaaagatctggttgtgtttgagtgtaagaagcgagccaagaacccagtagct
cccacagagaacaacacttctgtggggccagtgtccaacctttgctcattgggagccaaa
gatctgctccatgcacctgaggaaggaccttttacattccctaatggggaggctgtggaa
catggtgaggagagtaaggatcggaccatcatgctgatgggagtgtcctcacagaagatt
tctcttcggctgaagagggctgttgcccacaaggccacccagactgaatcacagccttgg
attggcagtgagggcccttcaggtccctttgtgctgtcttccccaaggaagacagcccag
gatactctatatgtgcttcccagtcccacctctccatgtcctagcccagtcttggtcaga
aagcgggcttttgtcaagtgggagaataaagactccctcataaaatcaaaggaggagctc
cgtcacctcagactgcctacctaccaagaactggaacaggaaataaatactctgaaagca
gataatgatgccctaaagatccaactgaaatatgcacagaagaaaatagaatccctccag
cttgaaaaaagcaatcatgtcttagctcaaatggagcagggtgactgttcttag

KEGG   Homo sapiens (human): 10235Help
Entry
10235             CDS       T01001                                 

Gene name
RASGRP2, CALDAG-GEFI, CDC25L
Definition
(RefSeq) RAS guanyl releasing protein 2
  KO
K12361  
RAS guanyl-releasing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Platelet activation
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    10235 (RASGRP2)
   04015 Rap1 signaling pathway
    10235 (RASGRP2)
   04010 MAPK signaling pathway
    10235 (RASGRP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    10235 (RASGRP2)
   04062 Chemokine signaling pathway
    10235 (RASGRP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10235 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q7LDG7(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.1
AA seq 609 aa AA seqDB search
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
EDGVFDIHL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaccctggacctggacaagggctgcacggtggaggagctgctccgcgggtgc
atcgaagccttcgatgactccgggaaggtgcgggacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccctcctctcagctggcggccaagctgctccacatctac
caacaatcccggaaggacaactccaattccctgcaggtgaaaacgtgccacctggtcagg
tactggatctccgccttcccagcggagtttgacttgaacccggagttggctgagcagatc
aaggagctgaaggctctgctagaccaagaagggaaccgacggcacagcagcctaatcgac
atagacagcgtccctacctacaagtggaagcggcaggtgactcagcggaaccctgtggga
cagaaaaagcgcaagatgtccctgttgtttgaccacctggagcccatggagctggcggag
catctcacctacttggagtatcgctccttctgcaagatcctgtttcaggactatcacagt
ttcgtgactcatggctgcactgtggacaaccccgtcctggagcggttcatctccctcttc
aacagcgtctcacagtgggtgcagctcatgatcctcagcaaacccacagccccgcagcgg
gccctggtcatcacacactttgtccacgtggcggagaagctgctacagctgcagaacttc
aacacgctgatggcagtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgttagccctgagaccatcaagctctgggagggtctcacggaactagtg
acggcgacaggcaactatggcaactaccggcgtcggctggcagcctgtgtgggcttccgc
ttcccgatcctgggtgtgcacctcaaggacctggtggccctgcagctggcactgcctgac
tggctggacccagcccggacccggctcaacggggccaagatgaagcagctctttagcatc
ctggaggagctggccatggtgaccagcctgcggccaccagtacaggccaaccccgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctgtaccagctg
tccctgcagcgggagccgcgctccaagtcctcgccaaccagccccacgagttgcacccca
ccaccccggcccccggtactggaggagtggacctcggctgccaaacccaagctggatcag
gccctcgtggtggagcacatcgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggatggccacatctcacaggaagaattccagatcatccgtgggaacttcccttac
ctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggagatg
gtttcctatttcctgcgctccagctctgtgttgggggggcgcatgggcttcgtacacaac
ttccaggagagcaactccttgcgccccgtcgcctgccgccactgcaaagccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggagtgaactgccacaagcagtgc
aaggatcgcctgtcagttgagtgtcggcgcagggcccagagtgtgagcctggaggggtct
gcaccctcaccctcacccatgcacagccaccatcaccgcgccttcagcttctctctgccc
cgccctggcaggcgaggctccaggcctccagagatccgtgaggaggaggtacagacggtg
gaggatggggtgtttgacatccacttgtaa

KEGG   Homo sapiens (human): 115727Help
Entry
115727            CDS       T01001                                 

Gene name
RASGRP4
Definition
(RefSeq) RAS guanyl releasing protein 4
  KO
K12363  
RAS guanyl-releasing protein 4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    115727 (RASGRP4)
   04010 MAPK signaling pathway
    115727 (RASGRP4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    115727 (RASGRP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q8TDF6(Tbio)
UniProt: 
Position
19q13.2
AA seq 673 aa AA seqDB search
MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQ
ICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDLLSPGGPGPPL
PMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPAL
EGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLHQLQNFNTLMAVTGGLCHS
AISRLKDSHAHLSPDSTKALLELTELLASHNNYARYRRTWAGCAGFRLPVLGVHLKDLVS
LHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTED
EIYELSYAREPRCPKSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYDP
EGRGTISQEDFERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFL
HTFHEVTFRKPTFCDSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDA
GPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPV
MDPPSTASSKLDS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaaagacagtaagaggaagtcccaccaggaatgcaccggaaaaataggaggg
cgaggccggccccgccaagtgcgccgccacaagacatgccccagccctcgggaaatcagc
aaggtcatggcttccatgaacctgggcctgctgagtgagggcggctgcagcgaagatgag
ctgctggagaaatgcatccagtccttcgattcagctggcagcctgtgccacgaggaccac
atgctcaacatggtgctggccatgcacagctgggtgctgccgtccgccgacctggctgcc
cgcctgctgacctcataccagaaggccacaggggacacccaggagctgagacggctgcag
atctgtcacctggtcaggtactggctgatgcgacaccctgaggtgatgcaccaggatccc
cagctagaagaagtcataggtcgtttctgggccaccgtggcccgggagggcaactcagcc
cagagaagactgggagactcttctgacctcctgagccctggtggccctggccccccactc
ccaatgagcagcccaggcctgggcaaaaagcgcaaagtgtccttgcttttcgaccacttg
gagacgggggagctggctcagcacctcacctacctggagttccggtccttccaggctatc
acgccccaggacctgcggagctacgttttgcagggctcagtacgaggctgcccggccctg
gagggctccgtaggtctcagcaacagcgtgtcccgctgggtgcaggtgatggtgctgagc
cgtcccgggcccctacagcgtgcacaggtgctggacaagttcattcacgtggcacagagg
ctccaccagctgcagaatttcaacacgctgatggcagtcacagggggcctgtgtcacagt
gccatctccagactcaaggactcccatgcccacctgagccctgacagcaccaaggccctc
ctggagctcactgagctccttgcctcccacaacaactacgcccgctaccgccgcacctgg
gctggctgcgcgggtttccggctgcctgtactgggcgtgcacctcaaggacctggtgtcc
ctgcatgaggcacagcccgacaggttgcctgacggccgcctgcacctacccaagctgaac
aacctctacctgcggctgcaggagctggtggccctccaagggcagcatccaccctgcagc
gccaatgaggatctgctgcacctgctcacgctctccctggacctcttctacacggaagac
gagatctatgagctttcttatgcccgggagccgcgttgtcccaagagcctgccaccctcc
cccttcaatgcacctctggtggtggagtgggcccctggtgtgacacccaagccggacagg
gtcacactgggtcggcatgtggagcagctggtggagtctgtgttcaagaattatgaccct
gaaggccgaggaacaatctctcaggaggactttgagcgactctcgggcaattttcccttc
gcctgccatgggcttcacccacccccacgccaggggagaggatccttcagcagagaggag
ctgacagggtacctgctccgggccagcgccatctgctccaagttgggcctggccttcctg
cacaccttccatgaggtcaccttccgaaagcctaccttctgcgacagctgcagtggcttc
ctctggggtgtcaccaagcaaggctaccgctgtcgggagtgcgggctgtgttgccacaaa
cactgcagagaccaggtgaaggtagaatgtaagaagaggccaggggccaagggcgatgca
ggaccccccggagctcctgtcccatccacaccagctccccatgccagctgtggctccgag
gaaaatcactcctacacgctatccctggagcctgagactgggtgccagcttcgccatgcc
tggacccagactgaatccccacacccttcctgggaaacagatacggtcccctgcccggtg
atggacccaccatcaactgcatcctccaagctggattcctag

KEGG   Homo sapiens (human): 25780Help
Entry
25780             CDS       T01001                                 

Gene name
RASGRP3, GRP3
Definition
(RefSeq) RAS guanyl releasing protein 3
  KO
K12362  
RAS guanyl-releasing protein 3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
B cell receptor signaling pathway
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    25780 (RASGRP3)
   04015 Rap1 signaling pathway
    25780 (RASGRP3)
   04010 MAPK signaling pathway
    25780 (RASGRP3)
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    25780 (RASGRP3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    25780 (RASGRP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8IV61(Tchem)
UniProt: 
Position
2p22.3
AA seq 690 aa AA seqDB search
MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYR
NATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRV
HAGVDVVDRGTEFELDQDEGEETRQDGEDG
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaagtggccttgggaaagcagcaacattagatgaactgctgtgcacttgcatt
gagatgtttgatgacaatggagagctggataatagttatttgccaagaatagttctactg
atgcaccgatggtatttatcttccactgaattggcagaaaaacttctctgcatgtatcga
aatgccactggagaaagctgcaatgaatttcgattaaagatctgctacttcatgaggtac
tggattctgaagtttcctgcagagtttaatttggatcttggtttgattcgtatgactgag
gaatttcgggaagtagctagtcaactaggatatgaaaaacacgtcagcctcatcgacata
tccagcattccttcctatgactggatgagaagagtcacacagaggaaaaaagtatccaag
aagggaaaagcctgtctgctgtttgaccatctggagcccattgaattggctgagcacctc
acttttctggagcataaatcttttagaaggatctcattcactgattaccaaagctatgtc
atccatggctgcctggagaataatccaaccttggaaagatcgattgctttatttaatgga
atctctaagtgggtccagttgatggttcttagcaaaccaaccccccagcaaagggcagaa
gtcatcacaaagtttatcaatgttgcaaagaagctccttcagctcaaaaattttaacacc
ctgatggcagtggtgggaggcctcagtcatagttccatttcacgcctcaaagagacccat
tctcatctttcttcagaagttacaaagaactggaatgaaatgacagagttggtctcctcc
aacggcaattactgcaattaccgcaaggcctttgccgactgcgatggcttcaaaatcccc
atccttggagtacacttgaaagacttgatagctgtccatgtcattttcccagactggaca
gaggagaacaaagtgaacattgtgaaaatgcaccagctctccgttaccctgagtgaacta
gtctccctgcagaatgcctctcaccacttagaacccaacatggatttgatcaacctgctc
acgctttccctggacctctatcacactgaagatgatatttacaaactgtcactggtgctg
gagcctagaaattctaaatcgcagcctacctcccctacgacgcccaacaagcctgtggta
cccctggagtgggcattaggggtgatgccaaagccagaccccacggtcatcaacaagcac
ataaggaaattagtggagtctgtatttagaaactatgatcacgaccatgatgggtacatt
tcccaagaggactttgaaagtatagctgccaattttcccttcttggattccttctgtgtt
ctggacaaagatcaggatggcctaattagtaaagatgaaatgatggcttacttcctgaga
gctaaatcccaactacactgtaaaatgggaccaggatttatccataattttcaggagatg
acctatctcaagccaaccttctgcgaacactgtgcgggatttctctggggcataatcaag
caaggatacaaatgcaaagactgtggagccaattgtcacaaacagtgcaaagacctcctg
gttctggcctgcaggagatttgcccgggcgccctccttgagcagtggtcatgggtcactg
cctggaagcccctcgctgcccccagcgcaggatgaggtgtttgagttccctggagtcact
gctggacacagggatttagacagcagagccatcacactggttacaggctcttctcgcaag
atctctgtgaggctacagagggccaccaccagccaggccacccagactgaacctgtctgg
tcagaggctggctggggggactcggggtcccacaccttccctaaaatgaaatccaagttc
catgacaaagcagcaaaggacaaaggctttgccaaatgggaaaatgagaagcccagggtg
catgctggtgtggatgttgtagaccggggcacggagtttgaacttgaccaggatgaagga
gaagagaccagacaggatggtgaggatggctga

DBGET integrated database retrieval system