KEGG   Homo sapiens (human): 10128Help
Entry
10128             CDS       T01001                                 

Gene name
LRPPRC, CLONE-23970, GP130, LRP130, LSFC
Definition
leucine-rich pentatricopeptide repeat containing
Orthology
K17964  
leucine-rich PPR motif-containing protein, mitochondrial
Organism
hsa  Homo sapiens (human)
Disease
H00072  
Pyruvate dehydrogenase complex deficiency
H01354  
Leigh syndrome
H01368  
Cytochrome c oxidase (COX) deficiency
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    10128 (LRPPRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p21
AA seq 1394 aa AA seqDB search
MAALLRSARWLLRAGAAPRLPLSLRLLPGGPGRLHAASYLPAARAGPVAGGLLSPARLYA
IAAKEKDIQEESTFSSRKISNQFDWALMRLDLSVRRTGRIPKKLLQKVFNDTCRSGGLGG
SHALLLLRSCGSLLPELKLEERTEFAHRIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFS
PTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVTEAVFSALVT
GHARAGDMENAENILTVMRDAGIEPGPDTYLALLNAYAEKGDIDHVKQTLEKVEKSELHL
MDRDLLQIIFSFSKAGYPQYVSEILEKVTCERRYIPDAMNLILLLVTEKLEDVALQILLA
CPVSKEDGPSVFGSFFLQHCVTMNTPVEKLTDYCKKLKEVQMHSFPLQFTLHCALLANKT
DLAKALMKAVKEEGFPIRPHYFWPLLVGRRKEKNVQGIIEILKGMQELGVHPDQETYTDY
VIPCFDSVNSARAILQENGCLSDSDMFSQAGLRSEAANGNLDFVLSFLKSNTLPISLQSI
RSSLLLGFRRSMNINLWSEITELLYKDGRYCQEPRGPTEAVGYFLYNLIDSMSDSEVQAK
EEHLRQYFHQLEKMNVKIPENIYRGIRNLLESYHVPELIKDAHLLVESKNLDFQKTVQLT
SSELESTLETLKAENQPIRDVLKQLILVLCSEENMQKALELKAKYESDMVTGGYAALINL
CCRHDKVEDALNLKEEFDRLDSSAVLDTGKYVGLVRVLAKHGKLQDAINILKEMKEKDVL
IKDTTALSFFHMLNGAALRGEIETVKQLHEAIVTLGLAEPSTNISFPLVTVHLEKGDLST
ALEVAIDCYEKYKVLPRIHDVLCKLVEKGETDLIQKAMDFVSQEQGEMVMLYDLFFAFLQ
TGNYKEAKKIIETPGIRARSARLQWFCDRCVANNQVETLEKLVELTQKLFECDRDQMYYN
LLKLYKINGDWQRADAVWNKIQEENVIPREKTLRLLAEILREGNQEVPFDVPELWYEDEK
HSLNSSSASTTEPDFQKDILIACRLNQKKGAYDIFLNAKEQNIVFNAETYSNLIKLLMSE
DYFTQAMEVKAFAETHIKGFTLNDAANSRLIITQVRRDYLKEAVTTLKTVLDQQQTPSRL
AVTRVIQALAMKGDVENIEVVQKMLNGLEDSIGLSKMVFINNIALAQIKNNNIDAAIENI
ENMLTSENKVIEPQYFGLAYLFRKVIEEQLEPAVEKISIMAERLANQFAIYKPVTDFFLQ
LVDAGKVDDARALLQRCGAIAEQTPILLLFLLRNSRKQGKASTVKSVLELIPELNEKEEA
YNSLMKSYVSEKDVTSAKALYEHLTAKNTKLDDLFLKRYASLLKYAGEPVPFIEPPESFE
FYAQQLRKLRENSS
NT seq 4185 nt NT seq  +upstreamnt  +downstreamnt
atggcagccctgctgagatccgcgcgttggttgctgcgtgccggggcggccccgcgcctc
ccgctctccctgcgcctcctccctggcggcccgggccggctgcatgccgcctcctatctg
cccgccgctcgcgccgggcccgtggccggaggactactgagcccagccaggctgtatgcc
attgctgccaaagaaaaagatattcaagaggagtccactttttcttctaggaagatttcc
aatcagtttgattgggctctaatgagactagatctttctgttcgaagaactggccgcatt
ccaaagaagcttctacaaaaagtttttaatgatacctgccgctcaggtggcctaggtggt
agtcatgccttgcttctactacgtagttgtggttctctcttgcctgaactaaagcttgaa
gagagaacagaatttgctcataggatatgggacacacttcagaaattaggtgctgtgtat
gatgtgagtcactataatgctttacttaaagtctatcttcaaaatgaatataaattctca
ccaactgatttcctggcaaaaatggaggaagcaaacattcaaccaaatcgagtgacatac
cagagattgattgcttcttattgtaatgtaggagatattgaaggtgccagcaagattctt
ggatttatgaaaactaaggatctcccagttacagaggcagtattcagtgcccttgtgaca
gggcatgccagagctggtgatatggagaatgcagaaaacattctcacagtgatgagagat
gccggaattgagcctggtccagacacatacctcgcattattgaatgcatatgctgagaag
ggcgacattgaccatgttaagcagactctggagaaggtggagaagtccgagcttcacctt
atggaccgtgatttactgcaaattatttttagcttcagtaaagctgggtatcctcagtat
gtctcagaaattttggaaaaagttacatgtgaaagaagatatattccagatgcaatgaac
ctcattttacttttagtcactgaaaaattggaagatgtagcgttgcaaattttactagca
tgccccgtatcaaaggaagatggcccaagtgtctttggcagtttctttttacaacactgt
gtgactatgaatacgcctgtggagaagctaacagactactgtaagaagttaaaggaagtc
cagatgcactcctttcctctgcagttcaccctccattgtgctttactcgccaataaaact
gatttggcaaaagccttaatgaaggctgtgaaggaggaaggttttcctatcagacctcac
tatttctggccattgctagttggacgtcggaaggaaaaaaatgttcaaggtataattgaa
atcctcaaaggaatgcaagaattgggagtacatcctgatcaggaaacatatacagattat
gtgattccatgctttgatagtgtaaactcagcacgagccattttgcaggaaaatggatgt
ctgtctgatagtgatatgttttctcaagctggattgagaagtgaagcagcaaatgggaac
ttagactttgtattatcatttttgaaatcaaatacattgcccatctcgctgcagtctata
agaagtagcctactgctaggcttcaggaggtctatgaatataaatctttggagcgagata
acagaattgttgtacaaggatggacgttattgccaggagcctcgaggaccgacggaagct
gttggctattttctttataacttgattgacagcatgagtgactcagaggtacaggccaag
gaggagcatttgagacaatacttccatcagctggagaagatgaatgtaaaaattcctgaa
aatatctacagaggcattcgtaatctcctggaaagctaccatgttcctgaattgattaag
gatgctcacttgttggttgagagtaagaatttagactttcaaaaaactgtgcaacttaca
tcatctgaattggagtccacacttgaaacactaaaagctgaaaatcaacctataagagat
gtcctaaagcaactcatattagtgctttgttcagaagagaatatgcaaaaagcccttgaa
ttgaaagcaaaatatgaatccgacatggttactggtggctatgcagctttaataaattta
tgctgtcgacatgataaagtagaagatgccttgaacttgaaagaagaatttgaccgctta
gattcatctgctgtccttgacaccggcaagtatgtaggccttgtaagagtattggcaaag
catggcaagctccaagatgctattaacattctgaaggagatgaaagagaaggatgttctt
atcaaagatacaacagccttgtcctttttccacatgctaaatggcgcagctttaagaggt
gaaattgaaacagtaaaacagttgcatgaagccatcgtgactctagggttagcagaacca
tccaccaacataagtttcccattggtcactgtacacttggaaaagggcgacctatctact
gctcttgaggtcgccattgactgctatgaaaagtataaagtattaccaaggattcatgat
gtcttgtgtaaactggtagagaaaggcgagactgatctaattcagaaagcaatggacttt
gtgagccaagaacaaggtgaaatggtgatgctctatgatctcttctttgccttcctacaa
acaggaaattacaaagaggccaagaagatcattgagactccagggattagagctcgatct
gcaaggcttcagtggttttgtgacagatgtgttgcaaataatcaggttgaaactctggaa
aaattagtggagctgacacagaagctatttgaatgtgatagagaccagatgtactacaat
ctgctaaaactgtataaaataaacggtgactggcaaagagctgatgcagtctggaataaa
atccaagaagaaaatgttattcctcgtgaaaagacattaagattattagcagaaatcctt
agagagggtaaccaggaagttccgtttgacgtacctgagttgtggtatgaagatgaaaaa
cattccctgaattcttcgtcagcctcaaccacagaacctgatttccagaaagatatattg
attgcctgccgattgaaccaaaaaaaaggggcatatgatattttcctgaatgcaaaagag
caaaacattgtgtttaatgctgaaacctacagcaatctcattaaattactgatgtcagaa
gattattttacacaagcaatggaagtgaaagcattcgcggagacccacatcaagggcttc
acactgaacgatgctgccaacagccgcctcatcataacgcaagttaggcgggattatttg
aaagaggctgtgacaacactgaaaacagtattggatcagcagcagaccccttctaggtta
gcagtgacccgtgtcatccaggcattggccatgaagggtgatgttgaaaacatagaagta
gttcagaagatgttaaatggactcgaagactccattggactttcaaaaatggttttcatc
aataacattgctttggctcaaataaagaataataacatagatgccgcaatagaaaacatt
gaaaatatgcttacttcagagaataaagtcattgaaccccaatacttcggcttggcatac
ttattcagaaaagtaatagaggagcagttggaaccagcagttgaaaagataagcatcatg
gcggagagattggccaatcagtttgcaatttataaacctgtcactgattttttccttcaa
cttgtggatgcaggcaaggtggatgatgccagagctctcctacagagatgtggtgcaatt
gctgaacaaaccccgattttgttgttgttcctccttaggaattctaggaaacaaggaaag
gcatcaactgtgaaatctgtgttagaattgattcctgaattaaatgaaaaggaagaagca
tacaattccctcatgaaaagctatgtctcagagaaagatgtcacatctgctaaagcactg
tatgaacatttgactgcaaagaatacaaaattggatgatctgtttctaaagcgttacgca
tctttgctgaagtatgctggagagcctgtccctttcattgaaccccctgaaagctttgaa
ttttatgcacagcagctaagaaaattgagggaaaactcttcttga

DBGET integrated database retrieval system