KEGG   Homo sapiens (human): 1013Help
Entry
1013              CDS       T01001                                 

Gene name
CDH15, CDH14, CDH3, CDHM, MCAD, MRD3
Definition
cadherin 15, type 1, M-cadherin (myotubule)
Orthology
K06809  
cadherin 15, M-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Disease
H00773  
Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1013 (CDH15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.3
AA seq 814 aa AA seqDB search
MDAAFLLVLGLLAQSLCLSLGVPGWRRPTTLYPWRRAPALSRVRRAWVIPPISVSENHKR
LPYPLVQIKSDKQQLGSVIYSIQGPGVDEEPRGVFSIDKFTGKVFLNAMLDREKTDRFRL
RAFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQEAFTGRVLEGAVPGTYVTRAEATDAD
DPETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGL
TATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGRLEVEDRDLPGSPNWVARFTI
LEGDPDGQFTIRTDPKTNEGVLSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQA
KVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPED
WLQVDAATGRIQTQHVLSPASPFLKGGWYRAIVLAQDDASQPRTATGTLSIEILEVNDHA
PVLAPPPPGSLCSEPHQGPGLLLGATDEDLPPHGAPFHFQLSPRLPELGRNWSLSQVNVS
HARLRPRHQVPEGLHRLSLLLRDSGQPPQQREQPLNVTVCRCGKDGVCLPGAAALLAGGT
GLSLGALVIVLASALLLLVLVLLVALRARFWKQSRGKGLLHGPQDDLRDNVLNYDEQGGG
EEDQDAYDISQLRHPTALSLPLGPPPLRRDAPQGRLHPQPPRVLPTSPLDIADFINDGLE
AADSDPSVPPYDTALIYDYEGDGSVAGTLSSILSSQGDEDQDYDYLRDWGPRFARLADMY
GHPCGLEYGARWDHQAREGLSPGALLPRHRGRTA
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgcgttcctcctcgtcctcgggctgttggcccagagcctctgcctgtctttg
ggggttcctggatggaggaggcccaccaccctgtacccctggcgccgggcgcctgccctg
agccgcgtgcggagggcctgggtcatccccccgatcagcgtatccgagaaccacaagcgt
ctcccctaccccctggttcagatcaagtcggacaagcagcagctgggcagcgtcatctac
agcatccagggacccggcgtggatgaggagccccggggcgtcttctctatcgacaagttc
acagggaaggtcttcctcaatgccatgctggaccgcgagaagactgatcgcttcaggcta
agagcgtttgccctggacctgggaggatccaccctggaggaccccacggacctggagatt
gtagttgtggatcagaatgacaaccggccagccttcctgcaggaggcgttcactggccgc
gtgctggagggtgcagtcccaggcacctatgtgaccagggcagaggccacagatgccgac
gaccccgagacggacaacgcagcgctgcggttctccatcctgcagcagggcagccccgag
ctcttcagcatcgacgagctcacaggagagatccgcacagtgcaagtggggctggaccgc
gaggtggtcgcggtgtacaatctgaccctgcaggtggcggacatgtctggagacggcctc
acagccactgcctcagccatcatcacccttgatgacatcaatgacaatgcccccgagttc
accagggatgagttcttcatggaggccatagaggccgtcagcggagtggatgtgggacgc
ctggaagtggaggacagggacctgccaggctccccaaactgggtggccaggttcaccatc
ctggaaggcgaccccgatgggcagttcaccatccgcacggaccccaagaccaacgagggt
gttctgtccattgtgaaggccctggactatgagagctgtgaacactacgaactcaaagtg
tcggtgcagaatgaggccccgctgcaggcggctgcccttagggctgagcggggccaggcc
aaggtccgcgtgcatgtgcaggacaccaacgagccccccgtgttccaggagaacccactt
cggaccagcctagcagagggggcacccccaggcactctggtggccaccttctctgcccgg
gaccctgacacagagcagctgcagaggctcagctactccaaggactacgacccggaagac
tggctgcaagtggacgcagccactggccggatccagacccagcacgtgctcagcccggcg
tcccccttcctcaagggcggctggtacagagccatcgtcctggcccaggatgacgcctcc
cagccccgcaccgccaccggcaccctgtccatcgagatcctggaggtgaacgaccatgca
cctgtgctggccccgccgccgccgggcagcctgtgcagcgagccacaccaaggcccaggc
ctcctcctgggcgccacggatgaggacctgcccccccacggggcccccttccacttccag
ctgagccccaggctcccagagctcggccggaactggagcctcagccaggtcaacgtgagc
cacgcgcgcctgcggccgcgacaccaggtccccgaaggcctgcaccgcctcagcctgctg
ctccgggactcggggcagccgccccagcagcgcgagcagcctctgaacgtgaccgtgtgc
cgctgcggcaaggacggcgtctgcctgccgggggccgcagcgctgctggcggggggcaca
ggcctcagcctgggcgcactggtcatcgtgctggccagcgccctcctgctgctggtgctg
gtcctgctcgtggcactccgggcgcggttctggaagcagtctcggggcaaggggctgctg
cacggcccccaggacgaccttcgagacaatgtcctcaactacgatgagcaaggaggcggg
gaggaggaccaggacgcctacgacatcagccagctgcgtcacccgacagcgctgagcctg
cctctgggaccgccgccacttcgcagagatgccccgcagggccgcctgcacccccagcca
ccccgagtgctgcccaccagccccctggacatcgccgacttcatcaatgatggcttggag
gctgcagatagtgaccccagtgtgccgccttacgacacagccctcatctatgactacgag
ggtgacggctcggtggcggggacgctgagctccatcctgtccagccagggcgatgaggac
caggactacgactacctcagagactgggggccccgcttcgcccggctggcagacatgtat
gggcacccgtgcgggttggagtacggggccagatgggaccaccaggccagggagggtctt
tctcctggggcactgctacccagacacagaggccggacagcctga

DBGET integrated database retrieval system