KEGG   Homo sapiens (human): 10134Help
Entry
10134             CDS       T01001                                 

Gene name
BCAP31, 6C6-AG, BAP31, CDM, DDCH, DXS1357E
Definition
(RefSeq) B-cell receptor associated protein 31
  KO
K14009  
B-cell receptor-associated protein 31
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10134 (BCAP31)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    10134 (BCAP31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P51572(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
Xq28
AA seq 246 aa AA seqDB search
MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILV
LLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLV
TLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEE
NRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
MDKKEE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcagtggactgcagttgccaccttcctctatgcggaggtctttgttgtgttg
cttctctgcattcccttcatttctcctaaaagatggcagaagattttcaagtcccggctg
gtggagttgttagtgtcctatggcaacaccttctttgtggttctcattgtcatccttgtg
ctgttggtcatcgatgccgtgcgcgaaattcggaagtatgatgatgtgacggaaaaggtg
aacctccagaacaatcccggggccatggagcacttccacatgaagcttttccgtgcccag
aggaatctctacattgctggcttttccttgctgctgtccttcctgcttagacgcctggtg
actctcatttcgcagcaggccacgctgctggcctccaatgaagcctttaaaaagcaggcg
gagagtgctagtgaggcggccaagaagtacatggaggagaatgaccagctcaagaaggga
gctgctgttgacggaggcaagttggatgtcgggaatgctgaggtgaagttggaggaagag
aacaggagcctgaaggctgacctgcagaagctaaaggacgagctggccagcactaagcaa
aaactagagaaagctgaaaaccaggttctggccatgcggaagcagtctgagggcctcacc
aaggagtacgaccgcttgctggaggagcacgcaaagctgcaggctgcagtagatggtccc
atggacaagaaggaagagtaa

DBGET integrated database retrieval system