KEGG   Homo sapiens (human): 10134Help
Entry
10134             CDS       T01001                                 

Gene name
BCAP31, 6C6-AG, BAP31, CDM, DDCH, DXS1357E
Definition
(RefSeq) B-cell receptor-associated protein 31
  KO
K14009  
B-cell receptor-associated protein 31
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10134 (BCAP31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq28
AA seq 246 aa AA seqDB search
MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILV
LLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLV
TLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEE
NRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
MDKKEE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcagtggactgcagttgccaccttcctctatgcggaggtctttgttgtgttg
cttctctgcattcccttcatttctcctaaaagatggcagaagattttcaagtcccggctg
gtggagttgttagtgtcctatggcaacaccttctttgtggttctcattgtcatccttgtg
ctgttggtcatcgatgccgtgcgcgaaattcggaagtatgatgatgtgacggaaaaggtg
aacctccagaacaatcccggggccatggagcacttccacatgaagcttttccgtgcccag
aggaatctctacattgctggcttttccttgctgctgtccttcctgcttagacgcctggtg
actctcatttcgcagcaggccacgctgctggcctccaatgaagcctttaaaaagcaggcg
gagagtgctagtgaggcggccaagaagtacatggaggagaatgaccagctcaagaaggga
gctgctgttgacggaggcaagttggatgtcgggaatgctgaggtgaagttggaggaagag
aacaggagcctgaaggctgacctgcagaagctaaaggacgagctggccagcactaagcaa
aaactagagaaagctgaaaaccaggttctggccatgcggaagcagtctgagggcctcacc
aaggagtacgaccgcttgctggaggagcacgcaaagctgcaggctgcagtagatggtccc
atggacaagaaggaagagtaa

DBGET integrated database retrieval system