KEGG   Homo sapiens (human): 10148Help
Entry
10148             CDS       T01001                                 

Gene name
EBI3, IL-27B, IL27B
Definition
Epstein-Barr virus induced 3
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 229 aa AA seqDB search
MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPV
SFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVP
FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRV
GPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcagcttctcctggcccttgtcctctgggccagctgcccgccctgcagtgga
aggaaagggcccccagcagctctgacactgccccgggtgcaatgccgagcctctcggtac
ccgatcgccgtggattgctcctggaccctgccgcctgctccaaactccaccagccccgtg
tccttcattgccacgtacaggctcggcatggctgcccggggccacagctggccctgcctg
cagcagacgccaacgtccaccagctgcaccatcacggatgtccagctgttctccatggct
ccctacgtgctcaatgtcaccgccgtccacccctggggctccagcagcagcttcgtgcct
ttcataacagagcacatcatcaagcccgaccctccagaaggcgtgcgcctaagccccctc
gctgagcgccagctacaggtgcagtgggagcctcccgggtcctggcccttcccagagatc
ttctcactgaagtactggatccgttacaagcgtcagggagctgcgcgcttccaccgggtg
gggcccattgaagccacgtccttcatcctcagggctgtgcggccccgagccaggtactac
gtccaagtggcggctcaggacctcacagactacggggaactgagtgactggagtctcccc
gccactgccacaatgagcctgggcaagtag

DBGET integrated database retrieval system