KEGG   Homo sapiens (human): 10148Help
Entry
10148             CDS       T01001                                 

Gene name
EBI3, IL-27B, IL27B, IL35B
Definition
(RefSeq) Epstein-Barr virus induced 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: fn3
Motif
Other DBs
NCBI-GeneID: 10148
NCBI-ProteinID: NP_005746
OMIM: 605816
HGNC: 3129
Ensembl: ENSG00000105246
Vega: OTTHUMG00000181866
Pharos: Q14213(Tbio)
UniProt: Q14213
Position
19p13.3
AA seq 229 aa AA seqDB search
MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPV
SFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVP
FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRV
GPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcagcttctcctggcccttgtcctctgggccagctgcccgccctgcagtgga
aggaaagggcccccagcagctctgacactgccccgggtgcaatgccgagcctctcggtac
ccgatcgccgtggattgctcctggaccctgccgcctgctccaaactccaccagccccgtg
tccttcattgccacgtacaggctcggcatggctgcccggggccacagctggccctgcctg
cagcagacgccaacgtccaccagctgcaccatcacggatgtccagctgttctccatggct
ccctacgtgctcaatgtcaccgccgtccacccctggggctccagcagcagcttcgtgcct
ttcataacagagcacatcatcaagcccgaccctccagaaggcgtgcgcctaagccccctc
gctgagcgccagctacaggtgcagtgggagcctcccgggtcctggcccttcccagagatc
ttctcactgaagtactggatccgttacaagcgtcagggagctgcgcgcttccaccgggtg
gggcccattgaagccacgtccttcatcctcagggctgtgcggccccgagccaggtactac
gtccaagtggcggctcaggacctcacagactacggggaactgagtgactggagtctcccc
gccactgccacaatgagcctgggcaagtag

DBGET integrated database retrieval system