KEGG   Homo sapiens (human): 10152Help
Entry
10152             CDS       T01001                                 

Gene name
ABI2, ABI-2, ABI2B, AIP-1, AblBP3, SSH3BP2, argBP1, argBPIA, argBPIB
Definition
abl-interactor 2
Orthology
K05751  
abl interactor 2
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10152 (ABI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33
AA seq 513 aa AA seqDB search
MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLAS
VAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQK
PPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRT
YSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSAS
APAPLVPATVPSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRH
TPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPP
PPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYV
IKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgcagatgctgctggaagaggaaatcccggggggccgccgggccctcttc
gacagctacacaaatctggaacgggtggccgattactgcgagaacaactacatacagtca
gcagataagcagagagccctagaagaaaccaaagcctacaccacccaatccttagcaagt
gttgcctatctgataaacaccttggccaacaatgtcctgcagatgctggatatccaggca
tcccagctacgaaggatggaatcttcaatcaatcatatttcacaaacagttgatattcat
aaagagaaagttgcaagaagagaaattggtattttgactaccaataaaaacacttcaagg
acacataagattattgctccagccaaccttgaacgaccagttcgttatattagaaaacct
attgactatacaattctagatgatattggacatggagtaaagtggttgcttagatttaag
gtgagtacccagaacatgaagatgggtgggctgccgcgtacaacacctccaactcagaag
ccccctagtccccctatgtcagggaaagggacacttgggcggcactccccctatcgcaca
ctggagccagtgcgtcctccagtggtaccaaatgattacgtacctagcccaacccgtaat
atggctccctcgcagcagagccctgtgaggacagcttctgtgaatcaaagaaatcgaact
tacagcagcagtgggagtagtggagggagccacccaagtagtcggagcagcagtcgagag
aacagtggaagtggtagtgtgggggttcctattgctgttcctactccatctcctcccagt
gtctttccagcccctgctggctctgctggcactcctccccttcctgctacttctgcatct
gcccctgctcctcttgttcctgctactgtcccttcctccactgccccagacgctgctgct
gggggtgcccagacccttgctgatggcttcacttctccaactccccctgttgtttcttcc
actccccctacaggtcatcctgtacagttctacagcatgaataggcctgcctctcgccat
actcccccaacaatagggggctcgttgccctatagacgccctccttccattacttcacaa
acaagccttcagaatcagatgaatggaggacctttttatagccagaatccagtttcagat
acaccacctccaccgccacctgtggaagaaccagtctttgatgagtctcccccacctcct
cctcctccagaagattacgaagaggaggaagctgctgtggttgagtatagtgatccttat
gctgaagaggacccaccgtgggctccacgttcttacttggaaaaggttgtggcaatttat
gactatacaaaagacaaggaagatgagctgtcctttcaggaaggagccattatttatgtc
atcaagaagaatgacgatggttggtatgagggagttatgaatggagtgactgggcttttt
cctgggaattacgttgagtctatcatgcattattctgagtaa

DBGET integrated database retrieval system