KEGG   Homo sapiens (human): 10154Help
Entry
10154             CDS       T01001                                 

Gene name
PLXNC1, CD232, PLXN-C1, VESPR
Definition
(RefSeq) plexin C1
  KO
K06572  
plexin C
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    10154 (PLXNC1)
CD molecules [BR:hsa04090]
 Proteins
  10154 (PLXNC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O60486(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
12q22
AA seq 1568 aa AA seqDB search
MEVSRRKAPPRPPRPAAPLPLLAYLLALAAPGRGADEPVWRSEQAIGAIAASQEDGVFVA
SGSCLDQLDYSLEHSLSRLYRDQAGNCTEPVSLAPPARPRPGSSFSKLLLPYREGAAGLG
GLLLTGWTFDRGACEVRPLGNLSRNSLRNGTEVVSCHPQGSTAGVVYRAGRNNRWYLAVA
ATYVLPEPETASRCNPAASDHDTAIALKDTEGRSLATQELGRLKLCEGAGSLHFVDAFLW
NGSIYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSLV
EALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFKTAESHCKEGDQP
ERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVILGENLTSNCPEVIYEIK
EETPVFYKLVPDPVKNIYIYLTAGKEVRRIRVANCNKHKSCSECLTATDPHCGWCHSLQR
CTFQGDCVHSENLENWLDISSGAKKCPKIQIIRSSKEKTTVTMVGSFSPRHSKCMVKNVD
SSRELCQNKSQPNRTCTCSIPTRATYKDVSVVNVMFSFGSWNLSDRFNFTNCSSLKECPA
CVETGCAWCKSARRCIHPFTACDPSDYERNQEQCPVAVEKTSGGGRPKENKGNRTNQALQ
VFYIKSIEPQKVSTLGKSNVIVTGANFTRASNITMILKGTSTCDKDVIQVSHVLNDTHMK
FSLPSSRKEMKDVCIQFDGGNCSSVGSLSYIALPHCSLIFPATTWISGGQNITMMGRNFD
VIDNLIISHELKGNINVSEYCVATYCGFLAPSLKSSKVRTNVTVKLRVQDTYLDCGTLQY
REDPRFTGYRVESEVDTELEVKIQKENDNFNISKKDIEITLFHGENGQLNCSFENITRNQ
DLTTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIF
AAVGVTRHKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKH
FALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTLEKQKNFS
VKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNW
MSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVA
LNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLEL
QMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHC
HLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRA
PFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDG
CLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEM
EEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGLEEAQKQLLHVKVLFD
EKKKCKWM
NT seq 4707 nt NT seq  +upstreamnt  +downstreamnt
atggaggtctcccggaggaaggcgccgccgcgccccccgcgccccgcagcgccactgccc
ctgctcgcctatctgctggcactggcggctcccggccggggcgcggacgagcccgtgtgg
cggtcggagcaagccatcggagccatcgcggcgagccaggaggacggcgtgtttgtggcg
agcggcagctgcctggaccagctggactacagcctggagcacagcctctcgcgcctgtac
cgggaccaagcgggcaactgcacagagccggtctcgctggcgccccccgcgcggccccgg
cccgggagcagcttcagcaagctgctgctgccctaccgcgagggggcggccggcctcggg
gggctgctgctcaccggctggaccttcgaccggggcgcctgcgaggtgcggcccctgggc
aacctgagccgcaactccctgcgcaacggcaccgaggtggtgtcgtgccacccgcagggc
tcgacggccggcgtggtgtaccgcgcgggccggaacaaccgctggtacctggcggtggcc
gccacctacgtgctgcctgagccggagacggcgagccgctgcaaccccgcggcatccgac
cacgacacggccatcgcgctcaaggacacggaggggcgcagcctggccacgcaggagctg
gggcgcctcaagctgtgcgagggcgcgggcagcctgcacttcgtggacgcctttctctgg
aacggcagcatctacttcccctactacccctacaactacacgagcggcgctgccaccggc
tggcccagcatggcgcgcatcgcgcagagcaccgaggtgctgttccagggccaggcatcc
ctcgactgcggccacggccaccccgacggccgccgcctgctcctctcctccagcctagtg
gaggccctggacgtctgggcgggagtgttcagcgcggccgctggagagggccaggagcgg
cgctcccccaccaccacggcgctctgcctcttcagaatgagtgagatccaggcgcgcgcc
aagagggtcagctgggacttcaagacggccgagagccactgcaaagaaggggatcaacct
gaaagagtccaaccaatcgcatcatctaccttgatccattccgacctgacatccgtttat
ggcaccgtggtaatgaacaggactgttttattcttggggactggagatggccagttactt
aaggttattcttggtgagaatttgacttcaaattgtccagaggttatctatgaaattaaa
gaagagacacctgttttctacaaactcgttcctgatcctgtgaagaatatctacatttat
ctaacagctgggaaagaggtgaggagaattcgtgttgcaaactgcaataaacataaatcc
tgttcggagtgtttaacagccacagaccctcactgcggttggtgccattcgctacaaagg
tgcacttttcaaggagattgtgtacattcagagaacttagaaaactggctggatatttcg
tctggagcaaaaaagtgccctaaaattcagataattcgaagcagtaaagaaaagactaca
gtgactatggtgggaagcttctctccaagacactcaaagtgcatggtgaagaatgtggac
tctagcagggagctctgccagaataaaagtcagcccaaccggacctgcacctgtagcatc
ccaaccagagcaacctacaaagatgtttcagttgtcaacgtgatgttctccttcggttct
tggaatttatcagacagattcaactttaccaactgctcatcattaaaagaatgcccagca
tgcgtagaaactggctgcgcgtggtgtaaaagtgcaagaaggtgtatccaccccttcaca
gcttgcgacccttctgattatgagagaaaccaggaacagtgtccagtggctgtcgagaag
acatcaggaggaggaagacccaaggagaacaaggggaacagaaccaaccaggctttacag
gtcttctacattaagtccattgagccacagaaagtatcgacattagggaaaagcaacgtg
atagtaacgggagcaaactttacccgggcatcgaacatcacaatgatcctgaaaggaacc
agtacctgtgataaggatgtgatacaggttagccatgtgctaaatgacacccacatgaaa
ttctctcttccatcaagccggaaagaaatgaaggatgtgtgtatccagtttgatggtggg
aactgctcttctgtgggatccttatcctacattgctctgccacattgttcccttatattt
cctgctaccacctggatcagtggtggtcaaaatataaccatgatgggcagaaattttgat
gtaattgacaacttaatcatttcacatgaattaaaaggaaacataaatgtctctgaatat
tgtgtggcgacttactgcgggtttttagcccccagtttaaagagttcaaaagtgcgcacg
aatgtcactgtgaagctgagagtacaagacacctacttggattgtggaaccctgcagtat
cgggaggaccccagattcacggggtatcgggtggaatccgaggtggacacagaactggaa
gtgaaaattcaaaaagaaaatgacaacttcaacatttccaaaaaagacattgaaattact
ctcttccatggggaaaatgggcaattaaattgcagttttgaaaatattactagaaatcaa
gatcttaccaccatcctttgcaaaattaaaggcatcaagactgcaagcaccattgccaac
tcttctaagaaagttcgggtcaagctgggaaacctggagctctacgtcgagcaggagtca
gttccttccacatggtattttctgattgtgctccctgtcttgctagtgattgtcattttt
gcggccgtgggggtgaccaggcacaaatcgaaggagctgagtcgcaaacagagtcaacaa
ctagaattgctggaaagcgagctccggaaagagatacgtgacggctttgctgagctgcag
atggataaattggatgtggttgatagttttggaactgttcccttccttgactacaaacat
tttgctctgagaactttcttccctgagtcaggtggcttcacccacatcttcactgaagat
atgcataacagagacgccaacgacaagaatgaaagtctcacagctttggatgccctaatc
tgtaataaaagctttcttgttactgtcatccacacccttgaaaagcagaagaacttttct
gtgaaggacaggtgtctgtttgcctccttcctaaccattgcactgcaaaccaagctggtc
tacctgaccagcatcctagaggtgctgaccagggacttgatggaacagtgtagtaacatg
cagccgaaactcatgctgagacgcacggagtccgtcgtcgaaaaactcctcacaaactgg
atgtccgtctgcctttctggatttctccgggagactgtcggagagcccttctatttgctg
gtgacgactctgaaccagaaaattaacaagggtcccgtggatgtaatcacttgcaaagcc
ctgtacacacttaatgaagactggctgttgtggcaggttccggaattcagtactgtggca
ttaaacgtcgtctttgaaaaaatcccggaaaacgagagtgcagatgtctgtcggaatatt
tcagtcaatgttctcgactgtgacaccattggccaagccaaagaaaagattttccaagca
ttcttaagcaaaaatggctctccttatggacttcagcttaatgaaattggtcttgagctt
caaatgggcacacgacagaaagaacttctggacatcgacagttcctccgtgattcttgaa
gatggaatcaccaagctaaacaccattggccactatgagatatcaaatggatccactata
aaagtctttaagaagatagcaaattttacttcagatgtggagtactcggatgaccactgc
catttgattttaccagattcggaagcattccaagatgtgcaaggaaagagacatcgaggg
aagcacaagttcaaagtaaaagaaatgtatctgacaaagctgctgtcgaccaaggtggca
attcattctgtgcttgaaaaactttttagaagcatttggagtttacccaacagcagagct
ccatttgctataaaatacttttttgactttttggacgcccaggctgaaaacaaaaaaatc
acagatcctgacgtcgtacatatttggaaaacaaacagccttcctcttcgcttctgggta
aacatcctgaagaaccctcagtttgtctttgacattaagaagacaccacatatagacggc
tgtttgtcagtgattgcccaggcattcatggatgcattttctctcacagagcagcaacta
gggaaggaagcaccaactaataagcttctctatgccaaggatatcccaacctacaaagaa
gaagtaaaatcttattacaaagcaatcagggatttgcctccattgtcatcctcagaaatg
gaagaatttttaactcaggaatctaagaaacatgaaaatgaatttaatgaagaagtggcc
ttgacagaaatttacaaatacatcgtaaaatattttgatgagattctaaataaactagaa
agagaacgagggctggaagaagctcagaaacaactcttgcatgtaaaagtcttatttgat
gaaaagaagaaatgcaagtggatgtaa

DBGET integrated database retrieval system