KEGG   Homo sapiens (human): 10162Help
Entry
10162             CDS       T01001                                 

Gene name
LPCAT3, C3F, LPCAT, LPLAT_5, LPSAT, MBOAT5, OACT5, nessy
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 3
  KO
K13515  
lysophospholipid acyltransferase 5 [EC:2.3.1.23 2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ferroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    10162 (LPCAT3)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    10162 (LPCAT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     10162 (LPCAT3)
    2.3.1.-  
     10162 (LPCAT3)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   10162 (LPCAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6P1A2(Tbio)
UniProt: 
Position
12p13.31
AA seq 487 aa AA seqDB search
MASSAEGDEGTVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFLGYPFALFYRH
YLFYKETYLIHLFHTFTGLSIAYFNFGNQLYHSLLCIVLQFLILRLMGRTITAVLTTFCF
QMAYLLAGYYYTATGNYDIKWTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRG
VPSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKRLSLGLFY
LVGYTLLSPHITEDYLLTEDYDNHPFWFRCMYMLIWGKFVLYKYVTCWLVTEGVCILTGL
GFNGFEEKGKAKWDACANMKVWLFETNPRFTGTIASFNINTNAWVARYIFKRLKFLGNKE
LSQGLSLLFLALWHGLHSGYLVCFQMEFLIVIVERQAARLIQESPTLSKLAAITVLQPFY
YLVQQTIHWLFMGYSMTAFCLFTWDKWLKVYKSIYFLGHIFFLSLLFILPYIHKAMVPRK
EKLKKME
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcagcggagggggacgaggggactgtggtggcgctggcgggggttctgcag
tcgggtttccaggagctgagccttaacaagttggcgacgtccctgggcgcgtcagaacag
gcgctgcggctgatcatctccatcttcctgggttacccctttgctttgttttatcggcat
taccttttctacaaggagacctacctcatccacctcttccatacctttacaggcctctca
attgcttattttaactttggaaaccagctctaccactccctgctgtgtattgtgcttcag
ttcctcatccttcgactaatgggccgcaccatcactgccgtcctcactaccttttgcttc
cagatggcctaccttctggctggatactattacactgccaccggcaactacgatatcaag
tggacaatgccacattgtgttctgactttgaagctgattggtttggctgttgactacttt
gacggagggaaagatcagaattccttgtcctctgagcaacagaaatatgccatacgtggt
gttccttccctgctggaagttgctggtttctcctacttctatggggccttcttggtaggg
ccccagttctcaatgaatcactacatgaagctggtgcagggagagctgattgacatacca
ggaaagataccaaacagcatcattcctgctctcaagcgcctgagtctgggccttttctac
ctagtgggctacacactgctcagcccccacatcacagaagactatctcctcactgaagac
tatgacaaccaccccttctggttccgctgcatgtacatgctgatctggggcaagtttgtg
ctgtacaaatatgtcacctgttggctggtcacagaaggagtatgcattttgacgggcctg
ggcttcaatggctttgaagaaaagggcaaggcaaagtgggatgcctgtgccaacatgaag
gtgtggctctttgaaacaaacccccgcttcactggcaccattgcctcattcaacatcaac
accaacgcctgggtggcccgctacatcttcaaacgactcaagttccttggaaataaagaa
ctctctcagggtctctcgttgctattcctggccctctggcacggcctgcactcaggatac
ctggtctgcttccagatggaattcctcattgttattgtggaaagacaggctgccaggctc
attcaagagagccccaccctgagcaagctggccgccattactgtcctccagcccttctac
tatttggtgcaacagaccatccactggctcttcatgggttactccatgactgccttctgc
ctcttcacgtgggacaaatggcttaaggtgtataaatccatctatttccttggccacatc
ttcttcctgagcctactattcatattgccttatattcacaaagcaatggtgccaaggaaa
gagaagttaaagaagatggaataa

DBGET integrated database retrieval system