KEGG   Homo sapiens (human): 10163Help
Entry
10163             CDS       T01001                                 

Gene name
WASF2, IMD2, SCAR2, WASF4, WAVE2, dJ393P12.2
Definition
(RefSeq) WAS protein family member 2
  KO
K05748  WAS protein family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    10163 (WASF2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    10163 (WASF2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    10163 (WASF2)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    10163 (WASF2)
  Infectious diseases
   05132 Salmonella infection
    10163 (WASF2)
   05131 Shigellosis
    10163 (WASF2)
   05100 Bacterial invasion of epithelial cells
    10163 (WASF2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     10163 (WASF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH2 WASH_WAHD RasGAP
Motif
Other DBs
NCBI-GeneID: 10163
NCBI-ProteinID: NP_008921
OMIM: 605875
HGNC: 12733
Ensembl: ENSG00000158195
Vega: OTTHUMG00000003393
Pharos: Q9Y6W5(Tbio)
UniProt: Q9Y6W5
Position
1p36.11
AA seq 498 aa AA seqDB search
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVEN
VDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP
PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPD
FAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVE
YSDSEDDSSEFDEDDWSD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgccgttagtaacgaggaacatcgagccaaggcacctgtgccgtcagacgttgcctagc
gttagaagcgagctggaatgcgtgaccaacatcaccctggcaaatgtcatccgacagctg
ggcagcctgagtaaatatgcagaggacatttttggagagctctttactcaggcaaatacc
tttgcctctcgggtaagctcccttgctgagagggtcgaccgactacaggttaaagtcact
cagctggatcccaaggaagaagaagtgtcactgcaaggaatcaacacccgaaaagccttc
agaagttccaccattcaagaccagaagctttttgacagaaactctctcccagtgcctgtc
ttagaaacatacaatacctgtgatactcctccccctctcaacaatcttaccccttacagg
gacgatggaaaagaggcactcaaattctacacagacccttcatacttctttgatctttgg
aaggagaagatgctgcaggacaccaaggatatcatgaaagagaagagaaagcataggaaa
gaaaagaaagataatccaaatcgagggaatgtaaacccacgtaaaatcaagacacgtaag
gaagagtgggagaaaatgaagatggggcaagaatttgtggagtccaaagaaaagctgggg
acttctgggtatccacccactttggtgtaccagaatggcagcattggctgtgttgaaaac
gtggatgcaagtagctatccgccaccaccacagtcagactctgcttcttcaccttctcct
tccttctccgaggacaacttgcctcctccaccagcagaattcagttacccagtggacaac
caaagaggatctggtttggctggacccaaaagatccagtgtggtcagcccaagccatcca
ccaccagctcctcctctaggctctccaccaggccctaaacccgggtttgctccaccacct
gcccctccgccacctccgcctccaatgataggcatcccacctccaccaccgcctgtagga
tttgggtctccagggacgcctccaccaccctcacccccatctttcccacctcaccctgat
tttgctgcccctccacctcctcctccaccaccagcagctgactacccaactctgccacca
cctcccttgtcccagccaacaggaggagcacctcctcctccccctcctcctcctcctccg
gggccccctcctccccctttcactggtgcagatggccagcctgctataccaccaccgctt
tctgataccaccaagcccaagtcctccttgcctgccgtgagcgatgcccgtagcgacctg
ctttcagccatccgtcaaggttttcagctgcgcagggttgaggagcagcgggaacaagag
aagcgggatgttgtgggcaatgacgtggccaccatcttgtctcgtcgcattgctgttgag
tacagtgactcagaagatgactcctctgaatttgatgaggacgactggtccgattaa

DBGET integrated database retrieval system