KEGG   Homo sapiens (human): 10163Help
Entry
10163             CDS       T01001                                 

Gene name
WASF2, IMD2, SCAR2, WASF4, WAVE2, dJ393P12.2
Definition
WAS protein family, member 2
Orthology
K05748  
WAS protein family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10163 (WASF2)
  Cellular commiunity
   04520 Adherens junction
    10163 (WASF2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    10163 (WASF2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    10163 (WASF2)
   05131 Shigellosis
    10163 (WASF2)
   05100 Bacterial invasion of epithelial cells
    10163 (WASF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.11
AA seq 281 aa AA seqDB search
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVEN
VDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFRFSAAQG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgccgttagtaacgaggaacatcgagccaaggcacctgtgccgtcagacgttgcctagc
gttagaagcgagctggaatgcgtgaccaacatcaccctggcaaatgtcatccgacagctg
ggcagcctgagtaaatatgcagaggacatttttggagagctctttactcaggcaaatacc
tttgcctctcgggtaagctcccttgctgagagggtcgaccgactacaggttaaagtcact
cagctggatcccaaggaagaagaagtgtcactgcaaggaatcaacacccgaaaagccttc
agaagttccaccattcaagaccagaagctttttgacagaaactctctcccagtgcctgtc
ttagaaacatacaatacctgtgatactcctccccctctcaacaatcttaccccttacagg
gacgatggaaaagaggcactcaaattctacacagacccttcatacttctttgatctttgg
aaggagaagatgctgcaggacaccaaggatatcatgaaagagaagagaaagcataggaaa
gaaaagaaagataatccaaatcgagggaatgtaaacccacgtaaaatcaagacacgtaag
gaagagtgggagaaaatgaagatggggcaagaatttgtggagtccaaagaaaagctgggg
acttctgggtatccacccactttggtgtaccagaatggcagcattggctgtgttgaaaac
gtggatgcaagtagctatccgccaccaccacagtcagactctgcttcttcaccttctcct
tccttctccgaggacaacttgcctcctccaccagcagaattcaggttttcagctgcgcag
ggttga

DBGET integrated database retrieval system