KEGG   Homo sapiens (human): 10164Help
Entry
10164             CDS       T01001                                 

Gene name
CHST4, GST3, GlcNAc6ST2, HECGLCNAC6ST, LSST
Definition
(RefSeq) carbohydrate sulfotransferase 4 (EC:2.8.2.-)
  KO
K04746  
carbohydrate 6-sulfotransferase 4 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - keratan sulfate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    10164 (CHST4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     10164 (CHST4)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   10164 (CHST4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.2
AA seq 386 aa AA seqDB search
MLLPKKMKLLLFLVSQMAILALFFHMYSHNISSLSMKAQPERMHVLVLSSWRSGSSFVGQ
LFGQHPDVFYLMEPAWHVWMTFKQSTAWMLHMAVRDLIRAVFLCDMSVFDAYMEPGPRRQ
SSLFQWENSRALCSAPACDIIPQDEIIPRAHCRLLCSQQPFEVVEKACRSYSHVVLKEVR
FFNLQSLYPLLKDPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKED
QPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLP
HLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYR
HVRSEQEQRNLLLDLLSTWTVPEQIH
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgctactgcctaaaaaaatgaagctcctgctgtttctggtttcccagatggccatcttg
gctctattcttccacatgtacagccacaacatcagctccctgtctatgaaggcacagccc
gagcgcatgcacgtgctggttctgtcttcctggcgctctggctcttcttttgtggggcag
ctttttgggcagcacccagatgttttctacctgatggagcccgcctggcacgtgtggatg
accttcaagcagagcaccgcctggatgctgcacatggctgtgcgggatctgatacgggcc
gtcttcttgtgcgacatgagcgtctttgatgcctacatggaacctggtccccggagacag
tccagcctctttcagtgggagaacagccgggccctgtgttctgcacctgcctgtgacatc
atcccacaagatgaaatcatcccccgggctcactgcaggctcctgtgcagtcaacagccc
tttgaggtggtggagaaggcctgccgctcctacagccacgtggtgctcaaggaggtgcgc
ttcttcaacctgcagtccctctacccgctgctgaaagacccctccctcaacctgcatatc
gtgcacctggtccgggacccccgggccgtgttccgttcccgagaacgcacaaagggagat
ctcatgattgacagtcgcattgtgatggggcagcatgagcaaaaactcaagaaggaggac
caaccctactatgtgatgcaggtcatctgccaaagccagctggagatctacaagaccatc
cagtccttgcccaaggccctgcaggaacgctacctgcttgtgcgctatgaggacctggct
cgagcccctgtggcccagacttcccgaatgtatgaattcgtgggattggaattcttgccc
catcttcagacctgggtgcataacatcacccgaggcaagggcatgggtgaccacgctttc
cacacaaatgccagggatgcccttaatgtctcccaggcttggcgctggtctttgccctat
gaaaaggtttctcgacttcagaaagcctgtggcgatgccatgaatttgctgggctaccgc
cacgtcagatctgaacaagaacagagaaacctgttgctggatcttctgtctacctggact
gtccctgagcaaatccactaa

DBGET integrated database retrieval system