KEGG   Homo sapiens (human): 10165Help
Entry
10165             CDS       T01001                                 

Gene name
SLC25A13, ARALAR2, CITRIN, CTLN2
Definition
(RefSeq) solute carrier family 25 member 13
  KO
K15105  
solute carrier family 25 (mitochondrial aspartate/glutamate transporter), member 12/13
Organism
hsa  Homo sapiens (human)
Disease
H00185  
Citrullinemia (CTLN)
H01398  
Primary hyperammonemic disorders (Urea cycle disorders)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   10165 (SLC25A13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21.3
AA seq 675 aa AA seqDB search
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL
LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT
IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA
IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL
AGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGT
LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQR
STGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFM
HKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFF
GIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTP
ADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTY
ELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPL
FKPSVSTSKAIGGGP
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccaaggtggctttaaccaagagagcagatccagctgagcttagaacaata
tttttgaagtatgcaagcattgagaaaaacggtgaatttttcatgtcccccaatgacttt
gtcactcgatacttgaacatttttggagaaagccagcctaatccaaagactgtggaactt
ttaagtggagtggtggatcagaccaaagatggattaatatcttttcaagaatttgttgcc
tttgaatctgtcctgtgtgcccctgatgctttgtttatggtagcctttcagctgtttgac
aaagctggcaaaggagaagtaacttttgaggatgttaagcaagtttttggacagaccaca
attcatcaacatattccatttaactgggattcagaatttgtgcaactacattttggaaaa
gaaagaaaaagacacctgacatatgcggaatttactcagtttttattggaaatacaactg
gagcacgcaaagcaagcctttgtgcaacgggacaatgctaggactgggagagtcacagcc
atcgacttccgagacatcatggtcaccatccgcccccatgtcttgactccttttgtagaa
gaatgtctagtagctgctgctggaggtaccacatcccatcaagttagtttctcctatttt
aatggatttaattcgctccttaacaacatggaactcattagaaagatctatagcactctg
gctggcaccaggaaagatgttgaagtgactaaggaggagtttgttctggcagctcagaaa
tttggtcaggttacacccatggaagttgacatcttgtttcagttagcagatttatatgag
ccaaggggacgtatgaccttagcagacattgaacggattgctcctctggaagagggaact
ctgccctttaacttggctgaggcccagaggcagaaggcctcaggtgattcagctcgacca
gttcttctacaagttgcagagtcggcctacaggtttggtctgggttctgttgctggagct
gttggagccactgctgtgtatcctatcgatcttgtaaaaactcgaatgcagaaccaacga
tcaactggctcttttgtgggagaactcatgtataaaaacagctttgactgttttaagaaa
gtgctacgctatgaaggcttctttggactgtatagaggtctgttgccacagttattggga
gttgccccagagaaggccataaaacttacagtgaacgattttgtgagggataaatttatg
cacaaagatggttcggtcccacttgcagcagaaattcttgctggaggctgcgctggaggc
tcccaggtgattttcacaaatcctttagaaatcgtcaagatccgtttgcaagtggcagga
gaaatcaccactggtcctcgagtcagtgctctgtctgtcgtgcgggacctggggtttttt
gggatctacaagggtgccaaagcatgctttctgcgggacattcctttctcggccatctac
tttccgtgctatgctcatgtgaaggcttcctttgcaaatgaagatgggcaggttagccca
ggaagcctgctcttagctggtgccatagctggtatgcctgcagcatctttagtgacccct
gctgatgttatcaagacgagattacaggtggctgcccgggctggccaaaccacttacagc
ggagtgatagactgctttagaaagatactgcgtgaagaaggaccaaaagctctgtggaag
ggagctggtgctcgtgtatttcgatcctcaccccagtttggtgtaactttgctgacttac
gaattgctacagcgatggttctacattgattttggaggagtaaaacccatgggatcagag
ccagttcctaaatccaggatcaacctgcctgccccgaatcctgatcacgttgggggctac
aaactggcagttgctacatttgcagggattgaaaacaaatttggactttacctacctctc
ttcaagccatcagtatctacctcaaaggctattggtggaggcccatag

DBGET integrated database retrieval system