KEGG   Homo sapiens (human): 10165Help
Entry
10165             CDS       T01001                                 

Gene name
SLC25A13, ARALAR2, CITRIN, CTLN2
Definition
solute carrier family 25 (aspartate/glutamate carrier), member 13
Orthology
K15105  
solute carrier family 25 (mitochondrial aspartate/glutamate transporter), member 12/13
Organism
hsa  Homo sapiens (human)
Disease
H00185  
Citrullinemia (CTLN)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.3
AA seq 676 aa AA seqDB search
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL
LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT
IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA
IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL
AGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGT
LPFNLAEAQRQQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQ
RSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKF
MHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGF
FGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVT
PADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLT
YELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLP
LFKPSVSTSKAIGGGP
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccaaggtggctttaaccaagagagcagatccagctgagcttagaacaata
tttttgaagtatgcaagcattgagaaaaacggtgaatttttcatgtcccccaatgacttt
gtcactcgatacttgaacatttttggagaaagccagcctaatccaaagactgtggaactt
ttaagtggagtggtggatcagaccaaagatggattaatatcttttcaagaatttgttgcc
tttgaatctgtcctgtgtgcccctgatgctttgtttatggtagcctttcagctgtttgac
aaagctggcaaaggagaagtaacttttgaggatgttaagcaagtttttggacagaccaca
attcatcaacatattccatttaactgggattcagaatttgtgcaactacattttggaaaa
gaaagaaaaagacacctgacatatgcggaatttactcagtttttattggaaatacaactg
gagcacgcaaagcaagcctttgtgcaacgggacaatgctaggactgggagagtcacagcc
atcgacttccgagacatcatggtcaccatccgcccccatgtcttgactccttttgtagaa
gaatgtctagtagctgctgctggaggtaccacatcccatcaagttagtttctcctatttt
aatggatttaattcgctccttaacaacatggaactcattagaaagatctatagcactctg
gctggcaccaggaaagatgttgaagtgactaaggaggagtttgttctggcagctcagaaa
tttggtcaggttacacccatggaagttgacatcttgtttcagttagcagatttatatgag
ccaaggggacgtatgaccttagcagacattgaacggattgctcctctggaagagggaact
ctgccctttaacttggctgaggcccagaggcagcagaaggcctcaggtgattcagctcga
ccagttcttctacaagttgcagagtcggcctacaggtttggtctgggttctgttgctgga
gctgttggagccactgctgtgtatcctatcgatcttgtaaaaactcgaatgcagaaccaa
cgatcaactggctcttttgtgggagaactcatgtataaaaacagctttgactgttttaag
aaagtgctacgctatgaaggcttctttggactgtatagaggtctgttgccacagttattg
ggagttgccccagagaaggccataaaacttacagtgaacgattttgtgagggataaattt
atgcacaaagatggttcggtcccacttgcagcagaaattcttgctggaggctgcgctgga
ggctcccaggtgattttcacaaatcctttagaaatcgtcaagatccgtttgcaagtggca
ggagaaatcaccactggtcctcgagtcagtgctctgtctgtcgtgcgggacctggggttt
tttgggatctacaagggtgccaaagcatgctttctgcgggacattcctttctcggccatc
tactttccgtgctatgctcatgtgaaggcttcctttgcaaatgaagatgggcaggttagc
ccaggaagcctgctcttagctggtgccatagctggtatgcctgcagcatctttagtgacc
cctgctgatgttatcaagacgagattacaggtggctgcccgggctggccaaaccacttac
agcggagtgatagactgctttagaaagatactgcgtgaagaaggaccaaaagctctgtgg
aagggagctggtgctcgtgtatttcgatcctcaccccagtttggtgtaactttgctgact
tacgaattgctacagcgatggttctacattgattttggaggagtaaaacccatgggatca
gagccagttcctaaatccaggatcaacctgcctgccccgaatcctgatcacgttgggggc
tacaaactggcagttgctacatttgcagggattgaaaacaaatttggactttacctacct
ctcttcaagccatcagtatctacctcaaaggctattggtggaggcccatag

DBGET integrated database retrieval system