KEGG   Homo sapiens (human): 10166Help
Entry
10166             CDS       T01001                                 

Gene name
SLC25A15, D13S327, HHH, ORC1, ORNT1
Definition
(RefSeq) solute carrier family 25 member 15
  KO
K15101  solute carrier family 25 (mitochondrial ornithine transporter) member 2/15
Organism
hsa  Homo sapiens (human)
Disease
H01268  Hyperornithinemia-hyperammonemia-homocitrullinuria syndrome
H01398  Primary hyperammonemic disorders (Urea cycle disorders)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   10166 (SLC25A15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 10166
NCBI-ProteinID: NP_055067
OMIM: 603861
HGNC: 10985
Ensembl: ENSG00000102743
Vega: OTTHUMG00000016776
Pharos: Q9Y619(Tbio)
UniProt: Q9Y619
Position
13q14.11
AA seq 301 aa AA seqDB search
MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGF
RGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFA
ALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLRE
VPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVL
SMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEA
Y
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaatcctgctatccaggctgccattgacctcacagcgggggctgcaggaggt
acagcatgtgtactgaccgggcagccctttgacacaatgaaagtgaagatgcagacgttc
cctgacctgtaccggggcctcaccgactgctgcctgaagacttactcccaggtgggcttc
cgtggcttctacaagggtaccagtccagcactaatcgccaacatcgctgagaactcagtc
ctcttcatgtgctacggcttctgccagcaggtggtgcggaaagtggctggattggacaag
caggcaaagctgagtgatctgcagaatgcagccgccggttccttcgcctctgcctttgct
gcactggtgctctgccccacggagctcgtgaagtgccggctgcagaccatgtatgagatg
gagacatcagggaagatagccaagagccagaatacagtgtggtctgtcatcaaaagtatt
cttaggaaagatggccccttggggttctaccatggactctcaagcactttacttcgagaa
gtaccaggctatttcttcttcttcggtggctatgaactgagccggtccttttttgcatca
gggagatcaaaagatgaattaggccctgtacctttgatgttaagtggtggagttggtggg
atttgcctctggcttgcggtatacccagtggattgtatcaaatccagaattcaagttctt
tccatgtctggaaaacaggcaggatttatcagaacctttataaatgttgtgaaaaatgaa
ggaataacggccttatattctggactgaaacctactatgattcgagcattccctgccaat
ggagcactctttttggcctacgaatatagcaggaagttgatgatgaaccagttggaagca
tactga

DBGET integrated database retrieval system