KEGG   Homo sapiens (human): 10166Help
Entry
10166             CDS       T01001                                 

Gene name
SLC25A15, D13S327, HHH, ORC1, ORNT1
Definition
solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15
Orthology
K15101  
solute carrier family 25 (mitochondrial ornithine transporter) member 2/15
Organism
hsa  Homo sapiens (human)
Disease
H01268  
Hyperornithinemia-hyperammonemia-homocitrullinuria syndrome
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
13q14
AA seq 301 aa AA seqDB search
MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGF
RGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFA
ALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLRE
VPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVL
SMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEA
Y
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaatcctgctatccaggctgccattgacctcacagcgggggctgcaggaggt
acagcatgtgtactgaccgggcagccctttgacacaatgaaagtgaagatgcagacgttc
cctgacctgtaccggggcctcaccgactgctgcctgaagacttactcccaggtgggcttc
cgtggcttctacaagggtaccagtccagcactaatcgccaacatcgctgagaactcagtc
ctcttcatgtgctacggcttctgccagcaggtggtgcggaaagtggctggattggacaag
caggcaaagctgagtgatctgcagaatgcagccgccggttccttcgcctctgcctttgct
gcactggtgctctgccccacggagctcgtgaagtgccggctgcagaccatgtatgagatg
gagacatcagggaagatagccaagagccagaatacagtgtggtctgtcatcaaaagtatt
cttaggaaagatggccccttggggttctaccatggactctcaagcactttacttcgagaa
gtaccaggctatttcttcttcttcggtggctatgaactgagccggtccttttttgcatca
gggagatcaaaagatgaattaggccctgtacctttgatgttaagtggtggagttggtggg
atttgcctctggcttgcggtatacccagtggattgtatcaaatccagaattcaagttctt
tccatgtctggaaaacaggcaggatttatcagaacctttataaatgttgtgaaaaatgaa
ggaataacggccttatattctggactgaaacctactatgattcgagcattccctgccaat
ggagcactctttttggcctacgaatatagcaggaagttgatgatgaaccagttggaagca
tactga

DBGET integrated database retrieval system