KEGG   Homo sapiens (human): 10171Help
Entry
10171             CDS       T01001                                 

Gene name
RCL1, RNAC, RPCL1
Definition
(RefSeq) RNA terminal phosphate cyclase-like 1
  KO
K11108  
RNA 3'-terminal phosphate cyclase-like protein
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    10171 (RCL1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    10171 (RCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p24.1-p23
AA seq 373 aa AA seqDB search
MATQAHSLSYAGCNFLRQRLVLSTLSGRPVKIRKIRARDDNPGLRDFEASFIRLLDKITN
GSRIEINQTGTTLYYQPGLLYGGSVEHDCSVLRGIGYYLESLLCLAPFMKHPLKIVLRGV
TNDQVDPSVDVLKATALPLLKQFGIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPI
QLTDPGKIKRIRGMAYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVNSGKSPG
FGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCARLLLEEIYRGGCVDSTNQSL
ALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEELKGGDKVLMTC
VGIGFSNLSKTLK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcaggcgcactccctcagctacgcagggtgcaacttcttgcgccaacgtctg
gtcctgtctaccctgagcgggcgccccgtcaaaatccgaaagattcgggccagagacgac
aacccgggcctccgagattttgaagccagcttcataaggctattggacaaaataacgaat
ggttctcgaattgaaataaaccaaacaggaacaaccttatattatcagcctggcctcctg
tatggtggatctgtggaacatgactgtagcgtccttcgtggcattgggtattacctggag
agtcttctttgcttggctccatttatgaagcacccgttaaaaatagttctacgaggagtg
accaatgatcaggttgacccttcagttgatgttcttaaggcaacagcactccctttgttg
aaacaatttgggattgatggtgaatcatttgaactgaagattgtgcgacggggaatgcct
cccggaggaggaggcgaagtggttttctcatgtcctgtgaggaaggtcttgaagcccatt
caactcacagatccaggaaaaatcaaacgtattagaggaatggcgtactctgtacgtgtg
tcacctcagatggcgaaccggattgtggattctgcaaggagcatcctcaacaagttcata
cctgatatctatatttacacagatcacatgaaaggagtcaactctgggaagtctccgggc
tttgggttgtcactggttgctgagaccaccagtggcaccttcctcagtgctgaactggcc
tccaacccccagggccagggagcagcagtacttccagaggaccttggcaggaactgtgcc
cggctgctgctggaggaaatctacaggggtggatgcgtagactcgaccaaccaaagcctg
gcgctactactcatgacccttggacagcaggatgtttccaaagtcctgctaggccctctc
tctccctacacgatagaatttttgcggcatttgaagagctttttccagattatgtttaaa
attgaaaccaagccatgtggtgaagaactcaagggtggggataaagtgctgatgacctgt
gttggcattggtttctccaaccttagcaagaccctcaagtga

DBGET integrated database retrieval system