KEGG   Homo sapiens (human): 10171Help
Entry
10171             CDS       T01001                                 

Gene name
RCL1, RNAC, RPCL1
Definition
RNA terminal phosphate cyclase-like 1
Orthology
K11108  
RNA 3'-terminal phosphate cyclase-like protein
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p24.1-p23
AA seq 215 aa AA seqDB search
MPPGGGGEVVFSCPVRKVLKPIQLTDPGKIKRIRGMAYSVRVSPQMANRIVDSARSILNK
FIPDIYIYTDHMKGVNSGKSPGFGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRN
CARLLLEEIYRGGCVDSTNQSLALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIM
FKIETKPCGEELKGGDKVLMTCVGIGFSNLSKTLK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccggaggaggaggcgaagtggttttctcatgtcctgtgaggaaggtcttgaag
cccattcaactcacagatccaggaaaaatcaaacgtattagaggaatggcgtactctgta
cgtgtgtcacctcagatggcgaaccggattgtggattctgcaaggagcatcctcaacaag
ttcatacctgatatctatatttacacagatcacatgaaaggagtcaactctgggaagtct
ccgggctttgggttgtcactggttgctgagaccaccagtggcaccttcctcagtgctgaa
ctggcctccaacccccagggccagggagcagcagtacttccagaggaccttggcaggaac
tgtgcccggctgctgctggaggaaatctacaggggtggatgcgtagactcgaccaaccaa
agcctggcgctactactcatgacccttggacagcaggatgtttccaaagtcctgctaggc
cctctctctccctacacgatagaatttttgcggcatttgaagagctttttccagattatg
tttaaaattgaaaccaagccatgtggtgaagaactcaagggtggggataaagtgctgatg
acctgtgttggcattggtttctccaaccttagcaagaccctcaagtga

DBGET integrated database retrieval system